Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T32240
|
||||
Former ID |
TTDC00251
|
||||
Target Name |
Interleukin-15
|
||||
Gene Name |
IL15
|
||||
Synonyms |
IL-15; IL15
|
||||
Target Type |
Discontinued
|
||||
Disease | Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | ||||
Function |
Cytokine that stimulates the proliferation of T- lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
|
||||
BioChemical Class |
Cytokine: interleukin
|
||||
Target Validation |
T32240
|
||||
UniProt ID | |||||
Sequence |
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANN SLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
||||
Drugs and Mode of Action | |||||
Drug(s) | AMG-714 | Drug Info | Discontinued in Phase 1 | Rheumatoid arthritis | [1] |
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
Jak-STAT signaling pathway | |||||
TNF signaling pathway | |||||
Intestinal immune network for IgA production | |||||
HTLV-I infection | |||||
Herpes simplex infection | |||||
Rheumatoid arthritis | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
FSH Signaling Pathway | |||||
Leptin Signaling Pathway | |||||
PANTHER Pathway | Interleukin signaling pathway | ||||
WikiPathways | Cytokines and Inflammatory Response | ||||
References | |||||
REF 1 | Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.