Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T58093
|
||||
Former ID |
TTDR00267
|
||||
Target Name |
Peptide deformylase
|
||||
Gene Name |
def
|
||||
Synonyms |
PDF; Polypeptide deformylase; def
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
Infection of P. falciparum [ICD9: 84; ICD10: B50-B54] | |||||
Function |
Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions (By similarity).
|
||||
BioChemical Class |
Carbon-nitrogen hydrolase
|
||||
UniProt ID | |||||
EC Number |
EC 3.5.1.88
|
||||
Sequence |
MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDA VEV |
||||
Drugs and Mode of Action | |||||
Drug(s) | GSK1322322 | Drug Info | Phase 2 | Bacterial infections | [1] |
Actinonin | Drug Info | Terminated | Discovery agent | [2] | |
Inhibitor | 2-(3-BENZOYLPHENOXY)ETHYL(HYDROXY)FORMAMIDE | Drug Info | [3] | ||
3-Sulfinoalanine | Drug Info | [4] | |||
Actinonin | Drug Info | [5] | |||
Bb-3497 | Drug Info | [4] | |||
Cysteinesulfonic Acid | Drug Info | [4] | |||
Double Oxidized Cysteine | Drug Info | [4] | |||
Formic Acid | Drug Info | [4] | |||
HYDROXY[3-(6-METHYLPYRIDIN-2-YL)PROPYL]FORMAMIDE | Drug Info | [3] | |||
N-(2-Acetamido)Iminodiacetic Acid | Drug Info | [4] | |||
N-alkyl urea hydroxamic acids | Drug Info | [6] | |||
NVP-PDF386 (VRC4887) | Drug Info | [7] | |||
VRC3375 | Drug Info | [8] | |||
[HYDROXY(3-PHENYLPROPYL)AMINO]METHANOL | Drug Info | [3] | |||
Modulator | GSK1322322 | Drug Info | [9], [1] | ||
Binder | Hydroxamates | Drug Info | [10] | ||
References | |||||
REF 1 | Peptide deformylase: a new target in antibacterial, antimalarial and anticancer drug discovery. Curr Med Chem. 2015;22(2):214-36. | ||||
REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007111) | ||||
REF 3 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
REF 4 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 5 | Actinonin, a naturally occurring antibacterial agent, is a potent deformylase inhibitor. Biochemistry. 2000 Feb 15;39(6):1256-62. | ||||
REF 6 | N-alkyl urea hydroxamic acids as a new class of peptide deformylase inhibitors with antibacterial activity. Antimicrob Agents Chemother. 2002 Sep;46(9):2752-64. | ||||
REF 7 | Comparative spectrum and activity of NVP-PDF386 (VRC4887), a new peptide deformylase inhibitor. J Antimicrob Chemother. 2003 Jan;51(1):157-61. | ||||
REF 8 | Peptide deformylase inhibitors as antibacterial agents: identification of VRC3375, a proline-3-alkylsuccinyl hydroxamate derivative, by using an integrated combinatorial and medicinal chemistry approach. Antimicrob Agents Chemother. 2004 Jan;48(1):250-61. | ||||
REF 9 | Comparative analysis of the antibacterial activity of a novel peptide deformylase inhibitor, GSK1322322. Antimicrob Agents Chemother. 2013 May;57(5):2333-42. | ||||
REF 10 | Opportunities and challenges in antiparasitic drug discovery. Nat Rev Drug Discov. 2005 Sep;4(9):727-40. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.