Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T68698
|
||||
| Former ID |
TTDR00957
|
||||
| Target Name |
Adenosylhomocysteinase
|
||||
| Gene Name |
AHCY
|
||||
| Synonyms |
AdoHcyase; S-adenosyl-L-homocysteine hydrolase; SAH hydrolase; AHCY
|
||||
| Target Type |
Discontinued
|
||||
| Function |
Adenosylhomocysteine is a competitiveinhibitor of S- adenosyl-L-methionine-dependent methyl transferase reactions; therefore adenosylhomocysteinase may play a key role in the control of methylations via regulation of the intracellular concentration of adenosylhomocysteine.
|
||||
| BioChemical Class |
Ether hydrolase
|
||||
| Target Validation |
T68698
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.3.1.1
|
||||
| Sequence |
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVET
AVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYF KDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS CDGPFKPDHYRY |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | ARISTEROMYCIN | Drug Info | Terminated | Discovery agent | [1] |
| Neplanocin A | Drug Info | Terminated | Discovery agent | [2] | |
| Inhibitor | 3'-Oxo-Adenosine | Drug Info | [3] | ||
| 4(Z)-(5'-Deoxyadenosin-5'-ylidene)butanoic acid | Drug Info | [4] | |||
| 5'-deoxy-5'-ureidoadenosine | Drug Info | [5] | |||
| 5'-S-ethyl-5'-thioadenosine | Drug Info | [6] | |||
| 5(E)-(5'-Deoxyadenosin-5'-ylidene)pentanoic acid | Drug Info | [4] | |||
| 5-methylenearisteromycin | Drug Info | [7] | |||
| ARISTEROMYCIN | Drug Info | [7] | |||
| D-Eritadenine | Drug Info | [8] | |||
| DZNep | Drug Info | [9] | |||
| ERITADENINE | Drug Info | [10] | |||
| FLUORO-NEPLANOCIN A | Drug Info | [11] | |||
| Isopropyl Alcohol | Drug Info | [6] | |||
| Neplanocin A | Drug Info | [12] | |||
| Nicotinamide-Adenine-Dinucleotide | Drug Info | [8] | |||
| NORARISTEROMYCIN | Drug Info | [13] | |||
| Pathways | |||||
| BioCyc Pathway | Superpathway of methionine degradation | ||||
| Methionine degradation | |||||
| Cysteine biosynthesis | |||||
| KEGG Pathway | Cysteine and methionine metabolism | ||||
| Metabolic pathways | |||||
| PathWhiz Pathway | Selenoamino Acid Metabolism | ||||
| Betaine Metabolism | |||||
| Methionine Metabolism | |||||
| WikiPathways | Metabolism of amino acids and derivatives | ||||
| Trans-sulfuration and one carbon metabolism | |||||
| One Carbon Metabolism | |||||
| Trans-sulfuration pathway | |||||
| Phase II conjugation | |||||
| Folate Metabolism | |||||
| References | |||||
| REF 1 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007402) | ||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001045) | ||||
| REF 3 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January | ||||
| REF 4 | Bioorg Med Chem. 2008 May 15;16(10):5424-33. Epub 2008 Apr 12.Synthesis of 5'-functionalized nucleosides: S-Adenosylhomocysteine analogues with the carbon-5' and sulfur atoms replaced by a vinyl or halovinyl unit. | ||||
| REF 5 | Bioorg Med Chem Lett. 2007 Aug 15;17(16):4456-9. Epub 2007 Jun 8.Design, synthesis, and molecular modeling studies of 5'-deoxy-5'-ureidoadenosine: 5'-ureido group as multiple hydrogen bonding donor in the active site of S-adenosylhomocysteine hydrolase. | ||||
| REF 6 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
| REF 7 | Bioorg Med Chem. 2008 Apr 1;16(7):3809-15. Epub 2008 Jan 30.Synthesis of 2-modified aristeromycins and their analogs as potent inhibitors against Plasmodium falciparum S-adenosyl-L-homocysteine hydrolase. | ||||
| REF 8 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 9 | 3-Deazaneplanocin: a new and potent inhibitor of S-adenosylhomocysteine hydrolase and its effects on human promyelocytic leukemia cell line HL-60. Biochem Biophys Res Commun. 1986 Mar 13;135(2):688-94. | ||||
| REF 10 | Bioorg Med Chem. 2009 Sep 15;17(18):6707-14. Epub 2009 Jul 28.A new structural class of S-adenosylhomocysteine hydrolase inhibitors. | ||||
| REF 11 | Bioorg Med Chem Lett. 2004 Nov 15;14(22):5641-4.Synthesis of 5'-substituted fluoro-neplanocin A analogues: importance of a hydrogen bonding donor at 5'-position for the inhibitory activity of S-adenosylhomocysteine hydrolase. | ||||
| REF 12 | Molecular approaches for the treatment of hemorrhagic fever virus infections. Antiviral Res. 1993 Sep;22(1):45-75. | ||||
| REF 13 | Bioorg Med Chem Lett. 2008 Apr 15;18(8):2615-8. Epub 2008 Mar 14.Synthesis of 4'-modified noraristeromycins to clarify the effect of the 4'-hydroxyl groups for inhibitory activity against S-adenosyl-L-homocysteine hydrolase. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.