Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T70309
|
||||
Former ID |
TTDR01182
|
||||
Target Name |
3-oxo-5-alpha-steroid 4-dehydrogenase 1
|
||||
Gene Name |
SRD5A1
|
||||
Synonyms |
5-alpha reductase 1; S5AR; SR type 1; Steroid 5-alpha-reductase 1; SRD5A1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Acne vulgaris [ICD9: 706.1; ICD10: L70.0] | ||||
Prostate disease [ICD10: N42.9] | |||||
Function |
Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5- alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
|
||||
BioChemical Class |
Oxidoreductases acting on CH-CH group of donors
|
||||
Target Validation |
T70309
|
||||
UniProt ID | |||||
EC Number |
EC 1.3.1.22
|
||||
Sequence |
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY LRKFEEYPKFRKIIIPFLF |
||||
Drugs and Mode of Action | |||||
Drug(s) | FR-146687 | Drug Info | Phase 2 | Prostate disease | [1] |
MK-386 | Drug Info | Discontinued in Phase 2 | Acne vulgaris | [2] | |
AS-601811 | Drug Info | Discontinued in Phase 1 | Acne vulgaris | [3] | |
Bexlosteride | Drug Info | Terminated | Discovery agent | [4] | |
Inhibitor | (3-fluoro-4-(4-phenoxybenzoyl)phenyl)acetic acid | Drug Info | [5] | ||
(3-methyl-4-(4-phenoxybenzoyl)phenyl)acetic acid | Drug Info | [5] | |||
(E)-3-(4-(4-phenoxybenzoyl)phenyl)acrylic acid | Drug Info | [5] | |||
1,2,5,6-tetrahydro pyrido[1,2-a]quinolin-3-one | Drug Info | [6] | |||
1-Methyl-5-(4-phenylazo-phenyl)-piperidin-2-one | Drug Info | [7] | |||
1-Methyl-5-phenyl-piperidin-2-one | Drug Info | [7] | |||
19-nor-10-azasteroid skeleton | Drug Info | [8] | |||
2,3,5,6-Tetrafluoro-4-pentafluorophenylazo-phenol | Drug Info | [9] | |||
3,4,5,6-Tetrahydrobenzo[c]quinolizin-3-(4aH)-one | Drug Info | [6] | |||
4,4'-dihydroxyoctafluoroazobenzene | Drug Info | [9] | |||
4-(4-phenoxybenzoyl)benzoic acid | Drug Info | [5] | |||
4-Methyl-5,6-dihydro-pyrido[1,2-a]quinolin-3-one | Drug Info | [6] | |||
4-[4-(benzhydryloxy)benzoyl]benzoic acid | Drug Info | [5] | |||
4-[4-benzyloxy)benzoyl]benzoic acid | Drug Info | [5] | |||
5-(4-Chloro-phenyl)-1-methyl-piperidin-2-one | Drug Info | [7] | |||
5-(4-Chloro-phenyl)-1-methyl-piperidine-2-thione | Drug Info | [7] | |||
AS-601811 | Drug Info | [1], [10] | |||
Bexlosteride | Drug Info | [11] | |||
FR-146687 | Drug Info | [1] | |||
LY-266111 | Drug Info | [7] | |||
MK-386 | Drug Info | [11] | |||
{4-[4-(4-bromophenoxy)benzoyl]phenyl}acetic acid | Drug Info | [5] | |||
Pathways | |||||
BioCyc Pathway | Superpathway of steroid hormone biosynthesis | ||||
Allopregnanolone biosynthesis | |||||
Androgen biosynthesis | |||||
KEGG Pathway | Steroid hormone biosynthesis | ||||
NetPath Pathway | IL2 Signaling Pathway | ||||
PathWhiz Pathway | Androgen and Estrogen Metabolism | ||||
Reactome | Androgen biosynthesis | ||||
References | |||||
REF 1 | Pharmacokinetics and pharmacodynamics of TF-505, a novel nonsteroidal 5alpha-reductase inhibitor, in normal subjects treated with single or multiple doses. Br J Clin Pharmacol. 2002 Sep;54(3):283-94. | ||||
REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006173) | ||||
REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013228) | ||||
REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009929) | ||||
REF 5 | J Med Chem. 2006 Jan 26;49(2):748-59.Novel 5alpha-reductase inhibitors: synthesis, structure-activity studies, and pharmacokinetic profile of phenoxybenzoylphenyl acetic acids. | ||||
REF 6 | J Med Chem. 2000 Oct 5;43(20):3718-35.Benzo[c]quinolizin-3-ones: a novel class of potent and selective nonsteroidal inhibitors of human steroid 5alpha-reductase 1. | ||||
REF 7 | Bioorg Med Chem Lett. 2000 Sep 4;10(17):1909-11.Simple bi- and tricyclic inhibitors of human steroid 5alpha-reductase. | ||||
REF 8 | 19-nor-10-azasteroids: a novel class of inhibitors for human steroid 5alpha-reductases 1 and 2. J Med Chem. 1997 Mar 28;40(7):1112-29. | ||||
REF 9 | J Med Chem. 1990 Sep;33(9):2452-5.Hydroxyperfluoroazobenzenes: novel inhibitors of enzymes of androgen biosynthesis. | ||||
REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013228) | ||||
REF 11 | Bioorg Med Chem Lett. 2000 Feb 21;10(4):353-6.Synthesis of 8-chloro-benzo[c]quinolizin-3-ones as potent and selective inhibitors of human steroid 5alpha-reductase 1. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.