Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T76158
|
||||
Former ID |
TTDR01232
|
||||
Target Name |
Glutathione reductase, mitochondrial
|
||||
Gene Name |
GR3
|
||||
Synonyms |
GR; GRase; Glutathione reductase; GR3
|
||||
Target Type |
Research
|
||||
Function |
Maintains high levels of reduced glutathione in the cytosol.
|
||||
BioChemical Class |
Oxidoreductases acting on a sulfur group of donors
|
||||
Target Validation |
T76158
|
||||
UniProt ID | |||||
EC Number |
EC 1.8.1.7
|
||||
Sequence |
MVYDLIVIGGGSGGMAAARRAARHNAKVALVEKSRLGGTCVNVGCVPKKIMFNAASVHDI
LENSRHYGFDTKFSFNLPLLVERRDKYIQRLNNIYRQNLSKDKVDLYEGTASFLSENRIL IKGTKDNNNKDNGPLNEEILEGRNILIAVGNKPVFPPVKGIENTISSDEFFNIKESKKIG IVGSGYIAVELINVIKRLGIDSYIFARGNRILRKFDESVINVLENDMKKNNINIVTFADV VEIKKVSDKNLSIHLSDGRIYEHFDHVIYCVGRSPDTENLNLEKLNVETNNNYIVVDENQ RTSVNNIYAVGDCCMVKKSKEIEDLNLLKLYNEETYLNKKENVTEDIFYNVQLTPVAINA GRLLADRLFLKKTRKTNYKLIPTVIFSHPPIGTIGLSEEAAIQIYGKENVKIYESKFTNL FFSVYDIEPELKEKTYLKLVCVGKDELIKGLHIIGLNADEIVQGFAVALKMNATKKDFDE TIPIHPTAAEEFLTLQPWMK |
||||
Drugs and Mode of Action | |||||
Drug(s) | Methylene blue | Drug Info | Approved | Acquired methemoglobinemia | [1] |
Inhibitor | 1-(2'-chlorophenyl)penta-1,4-dien-3-one | Drug Info | [2] | ||
2,4,6 trinitrobenzene sulfonate 1,3-bis (2-chlorethyl)-1-nitrosourea | Drug Info | [3] | |||
3,6-Dihydroxy-Xanthene-9-Propionic Acid | Drug Info | [4] | |||
3,7-Bis-dimethylamino-phenothiazin-5-ylium | Drug Info | [5] | |||
3-(Prop-2-Ene-1-Sulfinyl)-Propene-1-Thiol | Drug Info | [4] | |||
3-Sulfinoalanine | Drug Info | [4] | |||
4-nitrobenzo[c][1,2,5]thiadiazole | Drug Info | [6] | |||
Flavin-Adenine Dinucleotide | Drug Info | [4] | |||
Glutathionylspermidine Disulfide | Drug Info | [4] | |||
Meta-Nitro-Tyrosine | Drug Info | [4] | |||
Methylene blue | Drug Info | [1] | |||
Nicotinamide-Adenine-Dinucleotide | Drug Info | [4] | |||
Oxidized glutathione | Drug Info | [3] | |||
Oxidized Glutathione Disulfide | Drug Info | [7] | |||
Trans-(1S(R),2S(R))-2-Hydroxycyclooctyl nitrate | Drug Info | [8] | |||
Trans-(R(S))-2-Hydroxy-1-phenylethyl nitrate | Drug Info | [8] | |||
References | |||||
REF 1 | Recombinant Plasmodium falciparum glutathione reductase is inhibited by the antimalarial dye methylene blue. FEBS Lett. 1998 Feb 6;422(3):311-4. | ||||
REF 2 | J Med Chem. 2005 Nov 17;48(23):7400-10.Irreversible inactivation of trypanothione reductase by unsaturated Mannich bases: a divinyl ketone as key intermediate. | ||||
REF 3 | The purification and properties of glutathione reductase from the cestode Moniezia expansa. Int J Biochem Cell Biol. 1995 Apr;27(4):393-401. | ||||
REF 4 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 5 | J Med Chem. 2004 Nov 18;47(24):5972-83.5-substituted tetrazoles as bioisosteres of carboxylic acids. Bioisosterism and mechanistic studies on glutathione reductase inhibitors as antimalarials. | ||||
REF 6 | Bioorg Med Chem Lett. 2006 Apr 15;16(8):2283-92. Epub 2006 Feb 3.Specific inhibitors of Plasmodium falciparum thioredoxin reductase as potential antimalarial agents. | ||||
REF 7 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January | ||||
REF 8 | Bioorg Med Chem Lett. 2009 Jul 1;19(13):3661-3. Epub 2009 Apr 24.In vitro inhibition of human erythrocyte glutathione reductase by some new organic nitrates. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.