Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T39380
|
||||
Former ID |
TTDI03355
|
||||
Target Name |
LPA2 receptor
|
||||
Gene Name |
LPAR2
|
||||
Synonyms |
LPAR2
|
||||
Target Type |
Research
|
||||
UniProt ID | |||||
Sequence |
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL |
||||
Agonist | 2-oleoyl-LPA | Drug Info | [525840] | ||
decyl dihydrogen phosphate | Drug Info | [526598] | |||
dodecyl-thiophosphate | Drug Info | [527648] | |||
dodecylphosphate | Drug Info | [526598] | |||
GRI977143 | Drug Info | [532039] | |||
LPA | Drug Info | [527101] | |||
NAEPA | Drug Info | [529681] | |||
oleoyl-thiophosphate | Drug Info | [527648] | |||
Antagonist | BrP-LPA | Drug Info | [530196] | ||
compound 15 | Drug Info | [529245] | |||
Ki16425 | Drug Info | [526829] | |||
References | |||||
Ref 525840 | Lysophosphatidic acid (LPA) receptors of the EDG family are differentially activated by LPA species. Structure-activity relationship of cloned LPA receptors. FEBS Lett. 2000 Jul 28;478(1-2):159-65. | ||||
Ref 526598 | Fatty alcohol phosphates are subtype-selective agonists and antagonists of lysophosphatidic acid receptors. Mol Pharmacol. 2003 May;63(5):1032-42. | ||||
Ref 526829 | Ki16425, a subtype-selective antagonist for EDG-family lysophosphatidic acid receptors. Mol Pharmacol. 2003 Oct;64(4):994-1005. | ||||
Ref 527101 | Synthesis and biological evaluation of phosphonic and thiophosphoric acid derivatives of lysophosphatidic acid. Bioorg Med Chem Lett. 2004 Jul 5;14(13):3473-6. | ||||
Ref 527648 | J Med Chem. 2005 Jul 28;48(15):4919-30.Synthesis, structure-activity relationships, and biological evaluation of fatty alcohol phosphates as lysophosphatidic acid receptor ligands, activators of PPARgamma, and inhibitors of autotaxin. | ||||
Ref 529245 | Discovery of potent LPA2 (EDG4) antagonists as potential anticancer agents. Bioorg Med Chem Lett. 2008 Feb 1;18(3):1037-41. | ||||
Ref 529681 | LPA and its analogs-attractive tools for elucidation of LPA biology and drug development. Curr Med Chem. 2008;15(21):2122-31. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.