Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T62390
|
||||
| Former ID |
TTDS00365
|
||||
| Target Name |
Tyrosine 3-monooxygenase
|
||||
| Gene Name |
TH
|
||||
| Synonyms |
Tyrosine 3-hydroxylase; TH
|
||||
| Target Type |
Successful
|
||||
| Disease | Dietary shortage [ICD9: 260-269; ICD10: E40-E46] | ||||
| Pheochromocytoma [ICD9: 194.0, 227.0, 255.6; ICD10: C74.1, D35.0] | |||||
| Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
| Function |
Plays an important role in the physiology of adrenergic neurones.
|
||||
| BioChemical Class |
Oxidoreductases acting on paired donors
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.14.16.2
|
||||
| Sequence |
MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTAAPAASYTPTP
RSPRFIGRRQSLIEDARKEREAAVAAAAAAVPSEPGDPLEAVAFEEKEGKAVLNLLFSPR ATKPSALSRAVKVFETFEAKIHHLETRPAQRPRAGGPHLEYFVRLEVRRGDLAALLSGVR QVSEDVRSPAGPKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEI AFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNI PQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCC HELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYG AGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYAS RIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | L-Phenylalanine | Drug Info | Approved | Dietary shortage | [540274], [550111] |
| L-Tyrosine | Drug Info | Approved | Dietary shortage | [468020], [550756] | |
| Metyrosine | Drug Info | Approved | Pheochromocytoma | [538495], [541992] | |
| Tetrahydrobiopterin | Drug Info | Approved | Dietary shortage | [537637], [540739] | |
| ProSavin | Drug Info | Phase 1/2 | Parkinson's disease | [524296] | |
| Inhibitor | 3-chlorotyrosine | Drug Info | [543389] | ||
| 3-iodotyrosine | Drug Info | [543389] | |||
| 7,8-dihydrobiopterin | Drug Info | [551393] | |||
| alpha-propyldopacetamide | Drug Info | [543389] | |||
| Meta-Tyrosine | Drug Info | [551393] | |||
| Binder | L-Phenylalanine | Drug Info | [535693], [536211], [536359] | ||
| L-Tyrosine | Drug Info | [535693], [536211] | |||
| Metyrosine | Drug Info | [536239] | |||
| Modulator | ProSavin | Drug Info | [551478] | ||
| Cofactor | Tetrahydrobiopterin | Drug Info | [536529] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | Catecholamine biosynthesis | ||||
| KEGG Pathway | Tyrosine metabolism | ||||
| Metabolic pathways | |||||
| Dopaminergic synapse | |||||
| Prolactin signaling pathway | |||||
| Parkinson' | |||||
| s disease | |||||
| Cocaine addiction | |||||
| Amphetamine addiction | |||||
| Alcoholism | |||||
| PANTHER Pathway | Adrenaline and noradrenaline biosynthesis | ||||
| Parkinson disease | |||||
| Dopamine receptor mediated signaling pathway | |||||
| Nicotine pharmacodynamics pathway | |||||
| Pathway Interaction Database | ATF-2 transcription factor network | ||||
| AP-1 transcription factor network | |||||
| p38 signaling mediated by MAPKAP kinases | |||||
| Alpha-synuclein signaling | |||||
| PathWhiz Pathway | Catecholamine Biosynthesis | ||||
| WikiPathways | Monoamine Transport | ||||
| SIDS Susceptibility Pathways | |||||
| Biogenic Amine Synthesis | |||||
| Dopaminergic Neurogenesis | |||||
| Metabolism of amino acids and derivatives | |||||
| Dopamine metabolism | |||||
| Parkinsons Disease Pathway | |||||
| Nicotine Activity on Dopaminergic Neurons | |||||
| References | |||||
| Ref 468020 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4791). | ||||
| Ref 524296 | ClinicalTrials.gov (NCT01856439) Long Term Safety and Efficacy Study of ProSavin in Parkinson's Disease. U.S. National Institutes of Health. | ||||
| Ref 537637 | Sapropterin: A New Therapeutic Agent for Phenylketonuria (September) (CE). Ann Pharmacother. 2009 Aug 4. | ||||
| Ref 538495 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017871. | ||||
| Ref 540274 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3313). | ||||
| Ref 540739 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5276). | ||||
| Ref 535693 | In situ and in vitro evidence for DCoH/HNF-1 alpha transcription of tyrosinase in human skin melanocytes. Biochem Biophys Res Commun. 2003 Feb 7;301(2):610-6. | ||||
| Ref 536211 | Effect of metals and phenylalanine on the activity of human tryptophan hydroxylase-2: comparison with that on tyrosine hydroxylase activity. Neurosci Lett. 2006 Jul 3;401(3):261-5. Epub 2006 Apr 11. | ||||
| Ref 536239 | Dopamine beta-hydroxylase deficiency. A genetic disorder of cardiovascular regulation. Hypertension. 1991 Jul;18(1):1-8. | ||||
| Ref 536359 | Selectivity and affinity determinants for ligand binding to the aromatic amino acid hydroxylases. Curr Med Chem. 2007;14(4):455-67. | ||||
| Ref 536529 | Biochemistry of postmortem brains in Parkinson's disease: historical overview and future prospects. J Neural Transm Suppl. 2007;(72):113-20. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.