Target Information

Target General Infomation
Target ID
T85616
Former ID
TTDC00075
Target Name
Thioredoxin
Gene Name
TXN
Synonyms
ADF; ATL-derived factor; SASP; Surface associated sulphydryl protein; TXN
Target Type
Clinical Trial
Disease Cancer [ICD9: 140-229; ICD10: C00-C96]
Function
ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55).
BioChemical Class
Thioredoxin
Target Validation
T85616
UniProt ID
P10599
Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Drugs and Mode of Action
Drug(s) PX-12 Drug Info Phase 2 Cancer [528013]
Inhibitor Acetate Ion Drug Info [551393]
Cacodylate Ion Drug Info [551393]
PX-12 Drug Info [536388], [536492], [536593]
Pathways
NetPath Pathway IL2 Signaling Pathway
RANKL Signaling Pathway
PANTHER Pathway Hypoxia response via HIF activation
Oxidative stress response
Pathway Interaction Database p38 MAPK signaling pathway
Signaling events mediated by PTP1B
TNF receptor signaling pathway
PathWhiz Pathway Purine Metabolism
Reactome Oxidative Stress Induced Senescence
Detoxification of Reactive Oxygen Species
TP53 Regulates Metabolic Genes
The NLRP3 inflammasome
WikiPathways NRF2 pathway
Nuclear Receptors Meta-Pathway
Detoxification of Reactive Oxygen Species
Human Complement System
Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways
TNF alpha Signaling Pathway
Metabolism of nucleotides
Selenium Micronutrient Network
References
Ref 528013The antitumor thioredoxin-1 inhibitor PX-12 (1-methylpropyl 2-imidazolyl disulfide) decreases thioredoxin-1 and VEGF levels in cancer patient plasma. J Lab Clin Med. 2006 Feb;147(2):83-90.
Ref 536388A Phase I pharmacokinetic and pharmacodynamic study of PX-12, a novel inhibitor of thioredoxin-1, in patients with advanced solid tumors. Clin Cancer Res. 2007 Apr 1;13(7):2109-14.
Ref 536492Gateways to clinical trials. Methods Find Exp Clin Pharmacol. 2007 Jun;29(5):359-73.
Ref 5365932-[(1-methylpropyl)dithio]-1H-imidazole inhibits tubulin polymerization through cysteine oxidation. Mol Cancer Ther. 2008 Jan;7(1):143-51.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.