Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T52450 Target Info
Target Name Matrix metalloproteinase-1 (MMP-1)
Synonyms Interstitial collagenase; Fibroblast collagenase; CLG
Target Type Successful Target
Gene Name MMP1
Biochemical Class Peptidase
UniProt ID
MMP1_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name c-Jun/c-Jun (AP-1) homodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Family AP-1(-like) components
Subfamily Jun
Regulation Type Increase
Regulation Mechanism Footprinting analysis indicated that promoter regions of the phorbol diester-(TPA-) inducible genes (also referred as MMP1) are recognized by a common cellular protein: the previously described transcription factor AP-1. [1]
Evidence Score (E-score) 2 +
1 Chloramphenicol Acetyltransferase Assay [2]
2 DNase I Footprint Analysis [1]
UniProt ID
JUN_HUMAN
Sequence
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Cytokines / Cytokine receptors [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interleukin 5 receptor alpha (IL5RA) Successful Target Target Info [3]
2 Interleukin-5 (IL5) Successful Target Target Info [4]
Fibronectin proteins [+] 1 Fibronectin proteins Co-regulated By This TF +
1 Fibronectin (FN1) Clinical trial Target Target Info [5]
Lipoprotein receptors [+] 1 Lipoprotein receptors Co-regulated By This TF +
1 Low-density lipoprotein receptor (LDL-R) Successful Target Target Info [6]
Peptidases [+] 2 Peptidases Co-regulated By This TF +
1 Matrix metalloproteinase-1 (MMP-1) Successful Target Target Info [1]
2 Matrix metalloproteinase-9 (MMP-9) Clinical trial Target Target Info [7]
References  Top
REF 1 Phorbol ester-inducible genes contain a common cis element recognized by a TPA-modulated trans-acting factor. Cell. 1987 Jun 19;49(6):729-39.
REF 2 Components of the nuclear signaling cascade that regulate collagenase gene expression in response to integrin-derived signals. J Cell Biol. 1995 Jun;129(6):1707-20.
REF 3 An AP-1 site in the promoter of the human IL-5R alpha gene is necessary for promoter activity in eosinophilic HL60 cells. FEBS Lett. 1998 Sep 4;434(3):251-4.
REF 4 Identification of transcription factor binding sites important in the regulation of the human interleukin-5 gene. J Biol Chem. 1997 Jun 27;272(26):16453-65.
REF 5 Cyclic AMP inhibits fibronectin gene expression in a newly developed granulosa cell line by a mechanism that suppresses cAMP-responsive element-dependent transcriptional activation. J Biol Chem. 1990 Oct 25;265(30):18219-26.
REF 6 Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21.
REF 7 Stimulation of 92-kDa gelatinase B promoter activity by ras is mitogen-activated protein kinase kinase 1-independent and requires multiple transcription factor binding sites including closely spaced PEA3/ets and AP-1 sequences. J Biol Chem. 1996 May 3;271(18):10672-80.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.