Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T61657 | Target Info | |||
Target Name | Retinoic acid receptor beta (RARB) | ||||
Synonyms | RAR-epsilon; RAR-beta; Nuclear receptor subfamily 1 group B member 2; NR1B2; HBV-activated protein; HAP | ||||
Target Type | Successful Target | ||||
Gene Name | RARB | ||||
Biochemical Class | Nuclear hormone receptor | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | Retinoic acid receptor alpha (RAR-A) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Retinoic acid receptors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | The RARBgene is transcriptionally up-regulated by RA and a functional RAR element in the RARB mediates trans-activation by RA. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
UniProt ID | |||||
Sequence |
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 2 Apolipoproteins Co-regulated By This TF | + | |||
Growth factors | [+] 1 Growth factors Co-regulated By This TF | + | |||
Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
Mitochondrial carriers | [+] 1 Mitochondrial carriers Co-regulated By This TF | + | |||
Nuclear hormone receptors | [+] 3 Nuclear hormone receptors Co-regulated By This TF | + | |||
TF Name | Retinoid X receptor alpha (RXR-A) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Retinoid X receptors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Retinoic acid (RA)-dependent activation of the RARB gene in embryonal carcinoma cells is mediated by binding of retinoid receptor heterodimers (RAR/RXR) to a RA response element (RARE) located closely to the TATA box. | [2] | |||
Evidence Score (E-score) | 2 | + | |||
UniProt ID | |||||
Sequence |
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Acyltransferases | [+] 1 Acyltransferases Co-regulated By This TF | + | |||
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
Ester hydrolases | [+] 1 Ester hydrolases Co-regulated By This TF | + | |||
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
Glycoproteins | [+] 2 Glycoproteins Co-regulated By This TF | + | |||
Kinases | [+] 1 Kinases Co-regulated By This TF | + | |||
Mitochondrial carriers | [+] 1 Mitochondrial carriers Co-regulated By This TF | + | |||
Nuclear hormone receptors | [+] 4 Nuclear hormone receptors Co-regulated By This TF | + | |||
TF Name | Retinoic acid receptor beta (RAR-B) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Retinoic acid receptors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | The RARBgene is transcriptionally up-regulated by RA and a functional RAR element in the RARB mediates trans-activation by RA. | [1] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
Growth factors | [+] 1 Growth factors Co-regulated By This TF | + | |||
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
Nuclear hormone receptors | [+] 2 Nuclear hormone receptors Co-regulated By This TF | + | |||
TF Name | Vitamin D3 receptor (VDR) homodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Vitamin D receptor | ||||
Regulation Mechanism | The study analyzed the effect of vitamin D on the response of the RARB promoter to RA in pituitary GH4C1 cells that coexpress receptors for retinoids and vitamin D. Incubation with vitamin D markedly reduced the response to RA caused by transcriptional interference of the VDR on the RARE. | [2] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSG DSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQK VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE VFGNEIS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
Nuclear hormone receptors | [+] 1 Nuclear hormone receptors Co-regulated By This TF | + | |||
TF Name | Orphan nuclear receptor TR2 (NR2C1) homodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Tll / COUP | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | The activation of RARB2 by the orphan nuclear receptor TR2 is mediated by the direct repeat-5 (DR5) element located in the RARB2 promoter. | [3] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILA
RQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKVFDLCVVCGDKA SGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMKQ DSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLTATPTFVTDSESTRSTGLLDSGM FMNIHPSGVKTESAVLMTSDKAESCQGDLSTLANVVTSLANLGKTKDLSQNSNEMSMIES LSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSVHLITGDSSIN YTEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQE NSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSTERRKLLMEHIF KLQEFCNSMVKLCIDGYEYAYLKAIVLFSPDHPSLENMEQIEKFQEKAYVEFQDYITKTY PDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNIRIDSVIPHILKMEPADYNSQIIG HSI |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Nuclear hormone receptors | [+] 1 Nuclear hormone receptors Co-regulated By This TF | + |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Identification of a retinoic acid responsive element in the retinoic acid receptor beta gene. Nature. 1990 Jan 11;343(6254):177-80. | ||||
REF 2 | Vitamin D represses retinoic acid-dependent transactivation of the retinoic acid receptor-beta2 promoter: the AF-2 domain of the vitamin D receptor is required for transrepression. Endocrinology. 1999 Jun;140(6):2898-907. | ||||
REF 3 | Constitutive activation of retinoic acid receptor beta2 promoter by orphan nuclear receptor TR2. J Biol Chem. 2000 Apr 21;275(16):11907-14. | ||||
REF 4 | The promoter context is a decisive factor in establishing selective responsiveness to nuclear class II receptors. EMBO J. 1997 May 15;16(10):2861-73. | ||||
REF 5 | Differential transcriptional regulation of the apoAI gene by retinoic acid receptor homo- and heterodimers in yeast. Nucleic Acids Res. 1996 Feb 15;24(4):566-72. | ||||
REF 6 | Binding specificity and modulation of the human ApoCIII promoter activity by heterodimers of ligand-dependent nuclear receptors. Biochemistry. 1999 Jan 19;38(3):964-75. | ||||
REF 7 | Acceleration of thrombomodulin gene transcription by retinoic acid: retinoic acid receptors and Sp1 regulate the promoter activity through interactions with two different sequences in the 5'-flanking region of human gene. J Biol Chem. 2001 Jan 26;276(4):2440-50. | ||||
REF 8 | Identification and characterization of a functional retinoic acid/thyroid hormone-response element upstream of the human insulin gene enhancer. Biochem J. 1995 Aug 1;309 ( Pt 3):863-70. | ||||
REF 9 | Heterodimeric retinoic acid receptor-beta and retinoid X receptor-alpha complexes stimulate expression of the intercellular adhesion molecule-1 gene. Cell Growth Differ. 1995 May;6(5):515-21. | ||||
REF 10 | The human uncoupling protein-3 gene promoter requires MyoD and is induced by retinoic acid in muscle cells. FASEB J. 2000 Nov;14(14):2141-3. | ||||
REF 11 | Regulatory mechanisms controlling human hepatocyte nuclear factor 4alpha gene expression. Mol Cell Biol. 2001 Nov;21(21):7320-30. | ||||
REF 12 | RAR gamma 2 expression is regulated through a retinoic acid response element embedded in Sp1 sites. Mol Cell Biol. 1992 Jul;12(7):2976-85. | ||||
REF 13 | Co-regulation of tissue-specific alternative human carnitine palmitoyltransferase Ibeta gene promoters by fatty acid enzyme substrate. J Biol Chem. 1998 Dec 4;273(49):32901-9. | ||||
REF 14 | Bile acid-activated nuclear receptor FXR suppresses apolipoprotein A-I transcription via a negative FXR response element. J Clin Invest. 2002 Apr;109(7):961-71. | ||||
REF 15 | Retinoids increase human apolipoprotein A-11 expression through activation of the retinoid X receptor but not the retinoic acid receptor. Mol Cell Biol. 1996 Jul;16(7):3350-60. | ||||
REF 16 | Mode of action of peroxisome proliferators as hypolipidemic drugs. Suppression of apolipoprotein C-III. J Biol Chem. 1995 Jun 2;270(22):13470-5. | ||||
REF 17 | LXRs control lipid-inducible expression of the apolipoprotein E gene in macrophages and adipocytes. Proc Natl Acad Sci U S A. 2001 Jan 16;98(2):507-12. | ||||
REF 18 | PPARalpha and PPARgamma activators direct a distinct tissue-specific transcriptional response via a PPRE in the lipoprotein lipase gene. EMBO J. 1996 Oct 1;15(19):5336-48. | ||||
REF 19 | Human calcium-sensing receptor gene. Vitamin D response elements in promoters P1 and P2 confer transcriptional responsiveness to 1,25-dihydroxyvitamin D. J Biol Chem. 2002 Aug 16;277(33):30337-50. | ||||
REF 20 | The orphan nuclear receptor LRH-1 potentiates the sterol-mediated induction of the human CETP gene by liver X receptor. J Biol Chem. 2001 Jul 6;276(27):24767-73. | ||||
REF 21 | The farnesoid X-activated receptor mediates bile acid activation of phospholipid transfer protein gene expression. J Biol Chem. 2000 Dec 15;275(50):39313-7. | ||||
REF 22 | T3 receptor suppression of Sp1-dependent transcription from the epidermal growth factor receptor promoter via overlapping DNA-binding sites. J Biol Chem. 1993 Jul 25;268(21):16065-73. | ||||
REF 23 | Identification of thyroid hormone response elements in the human fatty acid synthase promoter. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12260-5. | ||||
REF 24 | A retinoic acid-responsive element in the apolipoprotein AI gene distinguishes between two different retinoic acid response pathways. Mol Cell Biol. 1991 Jul;11(7):3814-20. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.