Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T92076 Target Info
Target Name Extracellular calcium-sensing receptor (CASR)
Synonyms hCasR; Parathyroid cell calciumreceptor; Parathyroid cell calcium-sensing receptor 1; Parathyroid calcium receptor; Parathyroid Cell calcium-sensing receptor; PCaR1; GPRC2A; CaSR
Target Type Successful Target
Gene Name CASR
Biochemical Class GPCR glutamate
UniProt ID
CASR_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name Vitamin D3 receptor (VDR) homodimer
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Family Thyroid hormone receptor-like factors
Subfamily Vitamin D receptor
Regulation Type Increase
Regulation Mechanism Custom programming of Mat Inspector version 2.2 (Genomatix Software) with consensus VDR/RXR half-sites revealed potential VDREs in both P1 and P2 promoters of the CASR. [1]
Evidence Score (E-score) 2 +
1 Luciferase Reporter Assay [2]
2 Nuclear Run-On Transcription Assay, Reporter Assay, Electrophoretic Mobility Shift Assay [1]
UniProt ID
VDR_HUMAN
Sequence
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSG
DSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV
TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGNEIS
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Extracellular calcium-sensing receptor (CASR) Successful Target Target Info [1]
Nuclear hormone receptors [+] 1 Nuclear hormone receptors Co-regulated By This TF +
1 Retinoic acid receptor beta (RARB) Successful Target Target Info [3]
TF Name Retinoid X receptor alpha (RXR-A)
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Family Thyroid hormone receptor-like factors
Subfamily Retinoid X receptors
Regulation Type Increase
Regulation Mechanism Custom programming of Mat Inspector version 2.2 (Genomatix Software) with consensus VDR/RXR half-sites revealed potential VDREs in both P1 and P2 promoters of the CASR. [1]
Evidence Score (E-score) 1 +
1 Nuclear Run-On Transcription Assay, Reporter Assay, Electrophoretic Mobility Shift Assay [1]
UniProt ID
RXRA_HUMAN
Sequence
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Acyltransferases [+] 1 Acyltransferases Co-regulated By This TF +
1 Carnitine O-palmitoyltransferase I (CPT1B) Successful Target Target Info [4]
Apolipoproteins [+] 4 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-I (APOA1) Clinical trial Target Target Info [5]
2 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [6]
3 Apolipoprotein C-III (ApoCIII) Clinical trial Target Target Info [7]
4 Apolipoprotein E (APOE) Clinical trial Target Target Info [8]
Ester hydrolases [+] 1 Ester hydrolases Co-regulated By This TF +
1 Lipoprotein lipase (LPL) Successful Target Target Info [9]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Extracellular calcium-sensing receptor (CASR) Successful Target Target Info [1]
Glycoproteins [+] 2 Glycoproteins Co-regulated By This TF +
1 Cholesteryl ester transfer protein (CETP) Clinical trial Target Target Info [10]
2 Phospholipid transfer protein (PLTP) Literature-reported Target Target Info [11]
Kinases [+] 1 Kinases Co-regulated By This TF +
1 Epidermal growth factor receptor (EGFR) Successful Target Target Info [12]
Mitochondrial carriers [+] 1 Mitochondrial carriers Co-regulated By This TF +
1 Mitochondrial uncoupling protein 3 (UCP3) Clinical trial Target Target Info [13]
Nuclear hormone receptors [+] 4 Nuclear hormone receptors Co-regulated By This TF +
1 Hepatocyte nuclear factor 4-alpha (HNF4A) Literature-reported Target Target Info [14]
2 Retinoic acid receptor beta (RARB) Successful Target Target Info [3]
3 Retinoic acid receptor gamma (RARG) Successful Target Target Info [15]
4 Retinoic acid receptor RXR-gamma (RXRG) Successful Target Target Info [16]
References  Top
REF 1 Human calcium-sensing receptor gene. Vitamin D response elements in promoters P1 and P2 confer transcriptional responsiveness to 1,25-dihydroxyvitamin D. J Biol Chem. 2002 Aug 16;277(33):30337-50.
REF 2 Extracellular calcium-sensing receptor activation induces vitamin D receptor levels in proximal kidney HK-2G cells by a mechanism that requires pho... J Biol Chem. 2008 Jan 4;283(1):175-83.
REF 3 Vitamin D represses retinoic acid-dependent transactivation of the retinoic acid receptor-beta2 promoter: the AF-2 domain of the vitamin D receptor is required for transrepression. Endocrinology. 1999 Jun;140(6):2898-907.
REF 4 Co-regulation of tissue-specific alternative human carnitine palmitoyltransferase Ibeta gene promoters by fatty acid enzyme substrate. J Biol Chem. 1998 Dec 4;273(49):32901-9.
REF 5 Bile acid-activated nuclear receptor FXR suppresses apolipoprotein A-I transcription via a negative FXR response element. J Clin Invest. 2002 Apr;109(7):961-71.
REF 6 Retinoids increase human apolipoprotein A-11 expression through activation of the retinoid X receptor but not the retinoic acid receptor. Mol Cell Biol. 1996 Jul;16(7):3350-60.
REF 7 Mode of action of peroxisome proliferators as hypolipidemic drugs. Suppression of apolipoprotein C-III. J Biol Chem. 1995 Jun 2;270(22):13470-5.
REF 8 LXRs control lipid-inducible expression of the apolipoprotein E gene in macrophages and adipocytes. Proc Natl Acad Sci U S A. 2001 Jan 16;98(2):507-12.
REF 9 PPARalpha and PPARgamma activators direct a distinct tissue-specific transcriptional response via a PPRE in the lipoprotein lipase gene. EMBO J. 1996 Oct 1;15(19):5336-48.
REF 10 The orphan nuclear receptor LRH-1 potentiates the sterol-mediated induction of the human CETP gene by liver X receptor. J Biol Chem. 2001 Jul 6;276(27):24767-73.
REF 11 The farnesoid X-activated receptor mediates bile acid activation of phospholipid transfer protein gene expression. J Biol Chem. 2000 Dec 15;275(50):39313-7.
REF 12 T3 receptor suppression of Sp1-dependent transcription from the epidermal growth factor receptor promoter via overlapping DNA-binding sites. J Biol Chem. 1993 Jul 25;268(21):16065-73.
REF 13 The human uncoupling protein-3 gene promoter requires MyoD and is induced by retinoic acid in muscle cells. FASEB J. 2000 Nov;14(14):2141-3.
REF 14 Regulatory mechanisms controlling human hepatocyte nuclear factor 4alpha gene expression. Mol Cell Biol. 2001 Nov;21(21):7320-30.
REF 15 RAR gamma 2 expression is regulated through a retinoic acid response element embedded in Sp1 sites. Mol Cell Biol. 1992 Jul;12(7):2976-85.
REF 16 Identification of thyroid hormone response elements in the human fatty acid synthase promoter. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12260-5.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.