Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T85158
(Former ID: TTDC00327)
|
|||||
| Target Name |
Lymphotoxin-alpha (LTA)
|
|||||
| Synonyms |
Tumor necrosis factor ligand superfamily member 1; TNFSF1; TNFB; TNF-beta; LT-alpha
|
|||||
| Gene Name |
LTA
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Rheumatoid arthritis [ICD-11: FA20] | |||||
| Function |
In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo. Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM.
Click to Show/Hide
|
|||||
| BioChemical Class |
Cytokine: tumor necrosis factor
|
|||||
| UniProt ID | ||||||
| Sequence |
MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST
LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY SPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ LSTHTDGIPHLVLSPSTVFFGAFAL Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T77INT | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | Anti-LT alpha | Drug Info | Phase 2 | Rheumatoid arthritis | [1] | |
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 6 KEGG Pathways | + | ||||
| 1 | Cytokine-cytokine receptor interaction | |||||
| 2 | NF-kappa B signaling pathway | |||||
| 3 | TNF signaling pathway | |||||
| 4 | Type I diabetes mellitus | |||||
| 5 | HTLV-I infection | |||||
| 6 | Herpes simplex infection | |||||
| NetPath Pathway | [+] 3 NetPath Pathways | + | ||||
| 1 | TCR Signaling Pathway | |||||
| 2 | IL2 Signaling Pathway | |||||
| 3 | RANKL Signaling Pathway | |||||
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | Apoptosis signaling pathway | |||||
| PID Pathway | [+] 2 PID Pathways | + | ||||
| 1 | IL4-mediated signaling events | |||||
| 2 | IL2 signaling events mediated by STAT5 | |||||
| Reactome | [+] 3 Reactome Pathways | + | ||||
| 1 | TNFR2 non-canonical NF-kB pathway | |||||
| 2 | TNFs bind their physiological receptors | |||||
| 3 | TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway | |||||
| WikiPathways | [+] 1 WikiPathways | + | ||||
| 1 | Apoptosis | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Clinical pipeline report, company report or official report of Genentech (2011). | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.