Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T02562
(Former ID: TTDR00630)
|
|||||
Target Name |
Prostaglandin E synthase (PTGES)
|
|||||
Synonyms |
p53-induced gene 12 protein; PIG12; PGES; PGE synthase; P53-induced apoptosis protein 12; Microsomal prostaglandin E synthase 1; Microsomal glutathione S-transferase 1-like 1; MPGES1; MPGES-1; MGST1L1; MGST1-L1
|
|||||
Gene Name |
PTGES
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Alzheimer disease [ICD-11: 8A20] | |||||
Function |
Catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2).
Click to Show/Hide
|
|||||
BioChemical Class |
Intramolecular oxidoreductase
|
|||||
UniProt ID | ||||||
EC Number |
EC 5.3.99.3
|
|||||
Sequence |
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK LRAPIRSVTYTLAQLPCASMALQILWEAARHL Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
HIT2.0 ID | T47HTN |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | AAD-2004 | Drug Info | Phase 1 | Alzheimer disease | [1] | |
Patented Agent(s) | [+] 3 Patented Agents | + | ||||
1 | Carboxylic acid derivative 1 | Drug Info | Patented | Neoplasm | [2], [3] | |
2 | Imidazole benzamide derivative 1 | Drug Info | Patented | Knee pain | [3] | |
3 | Methyl-piperidine compound 1 | Drug Info | Patented | Neoplasm | [2], [3] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 33 Inhibitor drugs | + | ||||
1 | AAD-2004 | Drug Info | [1] | |||
2 | Alpha-substituted pirinixic acid and pirinixic acid ester derivative 1 | Drug Info | [3] | |||
3 | Benzamide derivative 14 | Drug Info | [3] | |||
4 | Benzamide derivative 15 | Drug Info | [3] | |||
5 | Benzamide derivative 16 | Drug Info | [3] | |||
6 | Benzamide derivative 18 | Drug Info | [3] | |||
7 | Benzimidazole derivative 11 | Drug Info | [3] | |||
8 | Benzimidazole derivative 12 | Drug Info | [3] | |||
9 | Benzimidazole derivative 13 | Drug Info | [3] | |||
10 | Benzimidazole derivative 14 | Drug Info | [3] | |||
11 | Benzimidazole derivative 15 | Drug Info | [3] | |||
12 | Benzimidazole derivative 16 | Drug Info | [3] | |||
13 | Benzimidazole derivative 17 | Drug Info | [3] | |||
14 | Betais-sulfonylamino derivative 1 | Drug Info | [3] | |||
15 | Boswellia acid derivative 1 | Drug Info | [3] | |||
16 | Carboxylic acid derivative 1 | Drug Info | [3] | |||
17 | Imidazole benzamide derivative 1 | Drug Info | [3] | |||
18 | Imidazopyridine derivative 5 | Drug Info | [3] | |||
19 | Imidazopyridine derivative 6 | Drug Info | [3] | |||
20 | Imidazopyridine derivative 7 | Drug Info | [3] | |||
21 | Methyl-piperidine compound 1 | Drug Info | [3] | |||
22 | Phthalazinone derivative 1 | Drug Info | [3] | |||
23 | Piperidine carboxamide derivative 1 | Drug Info | [3] | |||
24 | PMID28627961-Compound-22 | Drug Info | [3] | |||
25 | PMID28627961-Compound-30 | Drug Info | [3] | |||
26 | PMID28627961-Compound-31 | Drug Info | [3] | |||
27 | PMID28627961-Compound-32 | Drug Info | [3] | |||
28 | PMID28627961-Compound-33 | Drug Info | [3] | |||
29 | PMID28627961-Compound-41 | Drug Info | [3] | |||
30 | PMID28627961-Compound-44 | Drug Info | [3] | |||
31 | Polycyclic compound 1 | Drug Info | [3] | |||
32 | Pyrimidine derivative 2 | Drug Info | [3] | |||
33 | L-655240 | Drug Info | [4] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
BioCyc | [+] 1 BioCyc Pathways | + | ||||
1 | C20 prostanoid biosynthesis | |||||
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | Arachidonic acid metabolism | |||||
2 | Metabolic pathways | |||||
NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
1 | IL1 Signaling Pathway | |||||
2 | TCR Signaling Pathway | |||||
Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
1 | Arachidonic Acid Metabolism | |||||
WikiPathways | [+] 2 WikiPathways | + | ||||
1 | Arachidonic acid metabolism | |||||
2 | Eicosanoid Synthesis |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Concurrent blockade of free radical and microsomal prostaglandin E synthase-1-mediated PGE2 production improves safety and efficacy in a mouse model of amyotrophic lateral sclerosis. J Neurochem. 2012 Sep;122(5):952-61. | |||||
REF 2 | VEGFR-2 inhibitors and the therapeutic applications thereof: a patent review (2012-2016).Expert Opin Ther Pat. 2017 Sep;27(9):987-1004. | |||||
REF 3 | Microsomal prostaglandin E2 synthase-1 inhibitors: a patent review.Expert Opin Ther Pat. 2017 Sep;27(9):1047-1059. | |||||
REF 4 | Inhibitors of the inducible microsomal prostaglandin E2 synthase (mPGES-1) derived from MK-886. Bioorg Med Chem Lett. 2005 Jul 15;15(14):3352-5. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.