Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T09538
(Former ID: TTDS00256)
|
|||||
| Target Name |
Alkaline phosphatase tissue-nonspecific (ALPL)
|
|||||
| Synonyms |
TNSALP; Liver/bone/kidney isozyme; Alkaline phosphatase, tissue-nonspecific isozyme; Alkaline phosphatase liver/bone/kidney isozyme; AP-TNAP
|
|||||
| Gene Name |
ALPL
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Genetic prion disease [ICD-11: 8E02] | |||||
| 2 | Parasitic infection [ICD-11: 1D0Y-1G2Z] | |||||
| Function |
This isozyme plays a key role in skeletal mineralization by regulating levels of diphosphate (PPi).
Click to Show/Hide
|
|||||
| BioChemical Class |
Phosphoric monoester hydrolase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 3.1.3.1
|
|||||
| Sequence |
MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG VKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDE KARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELN RNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIG QAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYV PHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALALYPLSVLF Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| ADReCS ID | BADD_A02053 ; BADD_A02260 ; BADD_A02422 ; BADD_A04520 ; BADD_A05675 ; BADD_A05900 | |||||
| HIT2.0 ID | T87QBF | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 2 Approved Drugs | + | ||||
| 1 | Asfotase alfa | Drug Info | Approved | Genetic disease | [2] | |
| 2 | Levamisole | Drug Info | Approved | Parasitic infection | [3] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | Asfotase alfa | Drug Info | [1] | |||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | Levamisole | Drug Info | [4] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
| 1 | Folate biosynthesis | |||||
| 2 | Metabolic pathways | |||||
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | FSH Signaling Pathway | |||||
| Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
| 1 | Vitamin B6 Metabolism | |||||
| WikiPathways | [+] 3 WikiPathways | + | ||||
| 1 | Endochondral Ossification | |||||
| 2 | BDNF signaling pathway | |||||
| 3 | AGE/RAGE pathway | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Enzyme-replacement therapy in life-threatening hypophosphatasia. N Engl J Med. 2012 Mar 8;366(10):904-13. | |||||
| REF 2 | ClinicalTrials.gov (NCT01176266) Open-Label Study of Asfotase Alfa in Infants and Children 5 Years of Age With Hypophosphatasia (HPP). U.S. National Institutes of Health. | |||||
| REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 4 | Characterization of rat heart alkaline phosphatase isoenzymes and modulation of activity. Braz J Med Biol Res. 2008 Jul;41(7):600-9. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.