Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T11211
(Former ID: TTDS00367)
|
|||||
| Target Name |
Androgen receptor (AR)
|
|||||
| Synonyms |
Testosterone receptor; Nuclear receptor subfamily 3 group C member 4; NR3C4; Dihydrotestosterone receptor; DHTR
Click to Show/Hide
|
|||||
| Gene Name |
AR
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 11 Target-related Diseases | + | ||||
| 1 | Acne vulgaris [ICD-11: ED80] | |||||
| 2 | Acute myeloid leukaemia [ICD-11: 2A60] | |||||
| 3 | Alcoholic liver disease [ICD-11: DB94] | |||||
| 4 | Breast cancer [ICD-11: 2C60-2C6Y] | |||||
| 5 | Chronic obstructive pulmonary disease [ICD-11: CA22] | |||||
| 6 | Female pelvic pain [ICD-11: GA34] | |||||
| 7 | Hypo-osmolality/hyponatraemia [ICD-11: 5C72] | |||||
| 8 | Low bone mass disorder [ICD-11: FB83] | |||||
| 9 | Mammary tumour [ICD-11: 2C60-2C6Z] | |||||
| 10 | Prostate cancer [ICD-11: 2C82] | |||||
| 11 | Testicular dysfunction [ICD-11: 5A81] | |||||
| Function |
Transcription factor activity is modulated by bound coactivator and corepressor proteins like ZBTB7A that recruits NCOR1 and NCOR2 to the androgen response elements/ARE on target genes, negatively regulating androgen receptor signaling and androgen-induced cell proliferation. Transcription activation is also down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3. Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.
Click to Show/Hide
|
|||||
| BioChemical Class |
Nuclear hormone receptor
|
|||||
| UniProt ID | ||||||
| Sequence |
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ
QQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQ SALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSAD LKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELC KAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAG KSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQ SRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAP YGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRL ETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN DCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKL TVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWA KALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSR MYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEII SVQVPKILSGKVKPIYFHTQ Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| ADReCS ID | BADD_A01831 | |||||
| HIT2.0 ID | T20JZ2 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 19 Approved Drugs | + | ||||
| 1 | ARN-509 | Drug Info | Approved | Acute myeloid leukaemia | [2] | |
| 2 | Bicalutamide | Drug Info | Approved | Prostate cancer | [3], [4] | |
| 3 | Clascoterone | Drug Info | Approved | Acne vulgaris | [5] | |
| 4 | Cyproterone | Drug Info | Approved | Prostate cancer | [6] | |
| 5 | Darolutamide | Drug Info | Approved | Prostate cancer | [7] | |
| 6 | Dromostanolone | Drug Info | Approved | Mammary tumour | [4], [8] | |
| 7 | Enzalutamide | Drug Info | Approved | Prostate cancer | [9] | |
| 8 | Ethylestrenol | Drug Info | Approved | Testosterone deficiency | [10] | |
| 9 | Fludrocortisone | Drug Info | Approved | Cerebral salt-wasting syndrome | [11], [12] | |
| 10 | Flufenamic Acid | Drug Info | Approved | Dysmenorrhea | [10], [13] | |
| 11 | Fluoxymesterone | Drug Info | Approved | Breast cancer | [4], [10], [14] | |
| 12 | Flutamide | Drug Info | Approved | Prostate cancer | [15], [16] | |
| 13 | Hydroxyflutamide | Drug Info | Approved | Prostate cancer | [17], [18] | |
| 14 | Nandrolone | Drug Info | Approved | Osteoporosis | [19], [4] | |
| 15 | Nilutamide | Drug Info | Approved | Prostate cancer | [20], [18] | |
| 16 | Oxandrolone | Drug Info | Approved | Alcoholic hepatitis | [21], [22] | |
| 17 | Prasterone | Drug Info | Approved | Chronic obstructive pulmonary disease | [23] | |
| 18 | Testosterone | Drug Info | Approved | Osteoporosis | [24], [25] | |
| 19 | Dihydrotestosterone | Drug Info | Phase 4 | Prostate hyperplasia | [26], [27] | |
| Clinical Trial Drug(s) | [+] 23 Clinical Trial Drugs | + | ||||
| 1 | HC-1119 | Drug Info | Phase 3 | Prostate cancer | [28] | |
| 2 | ZANOTERONE | Drug Info | Phase 3 | Prostate hyperplasia | [29] | |
| 3 | ASC-J9 | Drug Info | Phase 2 | Thrombosis | [30] | |
| 4 | ASCJ-9 | Drug Info | Phase 2 | Alopecia | [31] | |
| 5 | AZD5312 | Drug Info | Phase 2 | Prostate cancer | [32] | |
| 6 | MK-0773 | Drug Info | Phase 2 | Osteoporosis | [33] | |
| 7 | Testogen TDS | Drug Info | Phase 2 | Hypogonadism | [34] | |
| 8 | TOK-001 | Drug Info | Phase 2 | Prostate cancer | [35], [36] | |
| 9 | APC-100 | Drug Info | Phase 1/2 | Prostate cancer | [37] | |
| 10 | ARV-110 | Drug Info | Phase 1/2 | Prostate cancer | [38] | |
| 11 | ARV-471 | Drug Info | Phase 1/2 | Breast cancer | [39] | |
| 12 | ARV-766 | Drug Info | Phase 1/2 | Prostate cancer | [40] | |
| 13 | ONC1-13B | Drug Info | Phase 1/2 | Prostate cancer | [41] | |
| 14 | AC0176 | Drug Info | Phase 1 | Prostate cancer | [42] | |
| 15 | AZD-3514 | Drug Info | Phase 1 | Prostate cancer | [43] | |
| 16 | CC-94676 | Drug Info | Phase 1 | Prostate cancer | [44] | |
| 17 | Drug 2881078 | Drug Info | Phase 1 | Heart failure | [45] | |
| 18 | DT-200 | Drug Info | Phase 1 | Duchenne dystrophy | [46] | |
| 19 | EPI-7386 | Drug Info | Phase 1 | Prostate cancer | [47] | |
| 20 | PS-178990 | Drug Info | Phase 1 | Muscle atrophy | [48] | |
| 21 | RAD-140 | Drug Info | Phase 1 | Breast cancer | [32] | |
| 22 | TAS3681 | Drug Info | Phase 1 | Prostate cancer | [32] | |
| 23 | TESTOSTERONE BUCICLATE | Drug Info | Phase 1 | Contraception | [49] | |
| Discontinued Drug(s) | [+] 11 Discontinued Drugs | + | ||||
| 1 | GW-275919 | Drug Info | Discontinued in Phase 2 | Pain | [50] | |
| 2 | HE-2000 | Drug Info | Discontinued in Phase 2 | Cystic fibrosis | [51] | |
| 3 | NP-619 | Drug Info | Discontinued in Phase 2 | Alopecia | [52] | |
| 4 | Testosterone glucoside | Drug Info | Discontinued in Phase 2 | Hypogonadism | [53] | |
| 5 | GSK2849466 | Drug Info | Discontinued in Phase 1 | Heart failure | [54] | |
| 6 | LGD2941 | Drug Info | Discontinued in Phase 1 | Osteoporosis | [55] | |
| 7 | MX-4509 | Drug Info | Discontinued in Phase 1 | Neurological disorder | [56] | |
| 8 | Opterone | Drug Info | Discontinued in Phase 1 | Hormone deficiency | [57] | |
| 9 | PF-06260414 | Drug Info | Discontinued in Phase 1 | Cachexia | [58] | |
| 10 | LG-2293 | Drug Info | Terminated | Prostate cancer | [60] | |
| 11 | ZD-3980 | Drug Info | Terminated | Prostate hyperplasia | [61] | |
| Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
| 1 | GLPG-0492 | Drug Info | Preclinical | Cachexia | [59] | |
| Mode of Action | [+] 7 Modes of Action | + | ||||
| Inhibitor | [+] 22 Inhibitor drugs | + | ||||
| 1 | ARN-509 | Drug Info | [2] | |||
| 2 | Fludrocortisone | Drug Info | [67] | |||
| 3 | Flufenamic Acid | Drug Info | [68] | |||
| 4 | HC-1119 | Drug Info | [80] | |||
| 5 | ZANOTERONE | Drug Info | [81] | |||
| 6 | ASC-J9 | Drug Info | [82] | |||
| 7 | TOK-001 | Drug Info | [35] | |||
| 8 | APC-100 | Drug Info | [37] | |||
| 9 | EPI-7386 | Drug Info | [94] | |||
| 10 | HE-2000 | Drug Info | [97] | |||
| 11 | Opterone | Drug Info | [86] | |||
| 12 | 1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane | Drug Info | [105] | |||
| 13 | 11-methyl-6,11-dihydro-5H-benzo[a]carbazol-9-ol | Drug Info | [106] | |||
| 14 | 6,11-dihydrothiochromeno[4,3-b]indol-8-ol | Drug Info | [106] | |||
| 15 | Calusterone | Drug Info | [109] | |||
| 16 | OXENDLONE | Drug Info | [114] | |||
| 17 | Palodesangren C | Drug Info | [114] | |||
| 18 | Palodesangren D | Drug Info | [114] | |||
| 19 | Palodesangren E | Drug Info | [114] | |||
| 20 | RU-59063 | Drug Info | [115] | |||
| 21 | [3H]methyltrienolone | Drug Info | [108] | |||
| 22 | [3H]mibolerone | Drug Info | [115] | |||
| Antagonist | [+] 18 Antagonist drugs | + | ||||
| 1 | Bicalutamide | Drug Info | [1], [62] | |||
| 2 | Clascoterone | Drug Info | [5] | |||
| 3 | Cyproterone | Drug Info | [63] | |||
| 4 | Darolutamide | Drug Info | [7] | |||
| 5 | Flutamide | Drug Info | [1] | |||
| 6 | Hydroxyflutamide | Drug Info | [18], [71], [72] | |||
| 7 | Nilutamide | Drug Info | [74] | |||
| 8 | Prasterone | Drug Info | [76] | |||
| 9 | ONC1-13B | Drug Info | [90] | |||
| 10 | AZD-3514 | Drug Info | [92] | |||
| 11 | TAS3681 | Drug Info | [32] | |||
| 12 | MX-4509 | Drug Info | [72] | |||
| 13 | ARN34 | Drug Info | [71] | |||
| 14 | ASC-JMX2 | Drug Info | [107] | |||
| 15 | CH-4933468 | Drug Info | [107] | |||
| 16 | DL-3 | Drug Info | [107] | |||
| 17 | HYG-440 | Drug Info | [113] | |||
| 18 | SX-ARPC | Drug Info | [116] | |||
| Binder | [+] 2 Binder drugs | + | ||||
| 1 | Dromostanolone | Drug Info | [64], [65] | |||
| 2 | PS-178990 | Drug Info | [95] | |||
| Modulator | [+] 22 Modulator drugs | + | ||||
| 1 | Enzalutamide | Drug Info | [10] | |||
| 2 | Ethylestrenol | Drug Info | [66] | |||
| 3 | Dihydrotestosterone | Drug Info | [79] | |||
| 4 | AZD5312 | Drug Info | [84] | |||
| 5 | MK-0773 | Drug Info | [85] | |||
| 6 | Testogen TDS | Drug Info | [86] | |||
| 7 | Drug 2881078 | Drug Info | [93] | |||
| 8 | DT-200 | Drug Info | [46] | |||
| 9 | RAD-140 | Drug Info | [96] | |||
| 10 | GW-275919 | Drug Info | [50] | |||
| 11 | NP-619 | Drug Info | [98] | |||
| 12 | GSK2849466 | Drug Info | [99] | |||
| 13 | LGD2941 | Drug Info | [100] | |||
| 14 | PF-06260414 | Drug Info | [101] | |||
| 15 | GLPG-0492 | Drug Info | [102] | |||
| 16 | LG-2293 | Drug Info | [103] | |||
| 17 | ZD-3980 | Drug Info | [104] | |||
| 18 | Andromustine | Drug Info | [107] | |||
| 19 | ASC-JMZ1 | Drug Info | [107] | |||
| 20 | EPI-001 | Drug Info | [111] | |||
| 21 | GTx-027 | Drug Info | [112] | |||
| 22 | SARMs | Drug Info | [107] | |||
| Agonist | [+] 9 Agonist drugs | + | ||||
| 1 | Fluoxymesterone | Drug Info | [69], [70] | |||
| 2 | Nandrolone | Drug Info | [73] | |||
| 3 | Oxandrolone | Drug Info | [75] | |||
| 4 | Testosterone | Drug Info | [77], [78] | |||
| 5 | TESTOSTERONE BUCICLATE | Drug Info | [86] | |||
| 6 | Testosterone glucoside | Drug Info | [86] | |||
| 7 | Boldenone | Drug Info | [108] | |||
| 8 | Delta1-dihydrotestosterone | Drug Info | [110] | |||
| 9 | Testetrol | Drug Info | [117] | |||
| Enhancer | [+] 1 Enhancer drugs | + | ||||
| 1 | ASCJ-9 | Drug Info | [83] | |||
| Degrader | [+] 5 Degrader drugs | + | ||||
| 1 | ARV-110 | Drug Info | [87] | |||
| 2 | ARV-471 | Drug Info | [88] | |||
| 3 | ARV-766 | Drug Info | [89] | |||
| 4 | AC0176 | Drug Info | [91] | |||
| 5 | CC-94676 | Drug Info | [44] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Drug Binding Sites of Target | Top | |||||
|---|---|---|---|---|---|---|
| Ligand Name: Testosterone | Ligand Info | |||||
| Structure Description | Crystal structure of human androgen receptor ligand binding domain in complex with testosterone | PDB:2AM9 | ||||
| Method | X-ray diffraction | Resolution | 1.64 Å | Mutation | No | [118] |
| PDB Sequence |
QPIFLNVLEA
679 IEPGVVCAGH689 DNNQPDSFAA699 LLSSLNELGE709 RQLVHVVKWA719 KALPGFRNLH 729 VDDQMAVIQY739 SWMGLMVFAM749 GWRSFTNVNS759 RMLYFAPDLV769 FNEYRMHKSR 779 MYSQCVRMRH789 LSQEFGWLQI799 TPQEFLCMKA809 LLLFSIIPVD819 GLKNQKFFDE 829 LRMNYIKELD839 RIIACKRKNP849 TSCSRRFYQL859 TKLLDSVQPI869 ARELHQFTFD 879 LLIKSHMVSV889 DFPEMMAEII899 SVQVPKILSG909 KVKPIYFHTQ919 |
|||||
|
|
LEU701
3.806
LEU704
3.457
ASN705
2.662
LEU707
3.967
GLY708
4.007
GLN711
4.137
TRP741
3.863
MET742
3.752
MET745
3.519
VAL746
4.006
MET749
3.590
|
|||||
| Click to View More Binding Site Information of This Target and Ligand Pair | ||||||
| Ligand Name: Liothyronine | Ligand Info | |||||
| Structure Description | Androgen receptor with small molecule | PDB:2PIV | ||||
| Method | X-ray diffraction | Resolution | 1.95 Å | Mutation | No | [119] |
| PDB Sequence |
QPIFLNVLEA
679 IEPGVVCAGH689 DNNQPDSFAA699 LLSSLNELGE709 RQLVHVVKWA719 KALPGFRNLH 729 VDDQMAVIQY739 SWMGLMVFAM749 GWRSFTNVNS759 RMLYFAPDLV769 FNEYRMHKSR 779 MYSQCVRMRH789 LSQEFGWLQI799 TPQEFLCMKA809 LLLFSIIPVD819 GLKNQKFFDE 829 LRMNYIKELD839 RIIACKRKNP849 TSCSRRFYQL859 TKLLDSVQPI869 ARELHQFTFD 879 LLIKSHMVSV889 DFPEMMAEII899 SVQVPKILSG909 KVKPIYFHT
|
|||||
|
|
||||||
| Click to View More Binding Site Information of This Target and Ligand Pair | ||||||
| Click to View More Binding Site Information of This Target with Different Ligands | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Tissue Distribution
Human Pathway Affiliation
Biological Network Descriptors
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
|
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
| KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
|---|---|---|---|
| Oocyte meiosis | hsa04114 | Affiliated Target |
|
| Class: Cellular Processes => Cell growth and death | Pathway Hierarchy | ||
| Degree | 61 | Degree centrality | 6.55E-03 | Betweenness centrality | 7.32E-03 |
|---|---|---|---|---|---|
| Closeness centrality | 2.76E-01 | Radiality | 1.47E+01 | Clustering coefficient | 9.84E-02 |
| Neighborhood connectivity | 5.13E+01 | Topological coefficient | 3.54E-02 | Eccentricity | 11 |
| Download | Click to Download the Full PPI Network of This Target | ||||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) |
||||||
| Drug Resistance Mutation (DRM) |
||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
| 1 | Oocyte meiosis | |||||
| 2 | Pathways in cancer | |||||
| 3 | Prostate cancer | |||||
| NetPath Pathway | [+] 3 NetPath Pathways | + | ||||
| 1 | EGFR1 Signaling Pathway | |||||
| 2 | AndrogenReceptor Signaling Pathway | |||||
| 3 | FSH Signaling Pathway | |||||
| PID Pathway | [+] 7 PID Pathways | + | ||||
| 1 | Regulation of nuclear SMAD2/3 signaling | |||||
| 2 | Coregulation of Androgen receptor activity | |||||
| 3 | Regulation of Androgen receptor activity | |||||
| 4 | Nongenotropic Androgen signaling | |||||
| 5 | Regulation of nuclear beta catenin signaling and target gene transcription | |||||
| 6 | FOXA1 transcription factor network | |||||
| 7 | Notch-mediated HES/HEY network | |||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | Nuclear Receptor transcription pathway | |||||
| 2 | Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 | |||||
| WikiPathways | [+] 6 WikiPathways | + | ||||
| 1 | SIDS Susceptibility Pathways | |||||
| 2 | Integrated Pancreatic Cancer Pathway | |||||
| 3 | Prostate Cancer | |||||
| 4 | Integrated Breast Cancer Pathway | |||||
| 5 | Nuclear Receptors | |||||
| 6 | Androgen receptor signaling pathway | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Androgen receptor as a target in androgen-independent prostate cancer. Urology. 2002 Sep;60(3 Suppl 1):132-8; discussion 138-9. | |||||
| REF 2 | 2018 FDA drug approvals.Nat Rev Drug Discov. 2019 Feb;18(2):85-89. | |||||
| REF 3 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2863). | |||||
| REF 4 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
| REF 5 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020 | |||||
| REF 6 | Drug information of Cyproterone, 2008. eduDrugs. | |||||
| REF 7 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019 | |||||
| REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6947). | |||||
| REF 9 | Nat Rev Drug Discov. 2013 Feb;12(2):87-90. | |||||
| REF 10 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 11 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2873). | |||||
| REF 12 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010060. | |||||
| REF 13 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2447). | |||||
| REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2861). | |||||
| REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6943). | |||||
| REF 16 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075298. | |||||
| REF 17 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2862). | |||||
| REF 18 | Drug insight: role of the androgen receptor in the development and progression of prostate cancer. Nat Clin Pract Oncol. 2007 Apr;4(4):236-44. | |||||
| REF 19 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6949). | |||||
| REF 20 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2864). | |||||
| REF 21 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7092). | |||||
| REF 22 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 076761. | |||||
| REF 23 | Direct agonist/antagonist functions of dehydroepiandrosterone. Endocrinology. 2005 Nov;146(11):4568-76. | |||||
| REF 24 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2858). | |||||
| REF 25 | Emerging drugs for hypogonadism. Expert Opin Emerg Drugs. 2006 Nov;11(4):685-707. | |||||
| REF 26 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2856). | |||||
| REF 27 | ClinicalTrials.gov (NCT00062790) Effect Of Dutasteride On Intraprostatic Dihydrotestosterone (DHT) Levels. U.S. National Institutes of Health. | |||||
| REF 28 | ClinicalTrials.gov (NCT03850795) HC-1119 Versus Enzalutamide in Metastatic Castration-Resistant Prostate Cancer (mCRPC). U.S. National Institutes of Health. | |||||
| REF 29 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002570) | |||||
| REF 30 | ClinicalTrials.gov (NCT03612856) Safety and Efficacy Study of AB023 (Xisomab 3G3) in End Stage Renal Disease Patients on Chronic Hemodialysis. U.S. National Institutes of Health. | |||||
| REF 31 | ClinicalTrials.gov (NCT01289574) Topical ASC-J9 Cream for Acne. U.S. National Institutes of Health. | |||||
| REF 32 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 33 | ClinicalTrials.gov (NCT00529659) A Study of the Safety and Efficacy of MK-0773 in Women With Sarcopenia (Loss of Muscle Mass)(MK-0773-005). U.S. National Institutes of Health. | |||||
| REF 34 | ClinicalTrials.gov (NCT01894308) A Dose Ranging Study to Examine Testagen TDS-Testosterone 5%. U.S. National Institutes of Health. | |||||
| REF 35 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8638). | |||||
| REF 36 | Galeterone prevents androgen receptor binding to chromatin and enhances degradation of mutant androgen receptor. Clin Cancer Res. 2014 Aug 1;20(15):4075-85. | |||||
| REF 37 | 2011 Pipeline of Adamis Pharmaceuticals. | |||||
| REF 38 | ClinicalTrials.gov (NCT03888612) Trial of ARV-110 in Patients With Metastatic Castration Resistant Prostate Cancer (mCRPC). U.S. National Institutes of Health. | |||||
| REF 39 | ClinicalTrials.gov (NCT04072952) A Phase 1/2 Trial of ARV-471 Alone and in Combination With Palbociclib (IBRANCE) in Patients With ER+/HER2- Locally Advanced or Metastatic Breast Cancer (mBC). U.S. National Institutes of Health. | |||||
| REF 40 | ClinicalTrials.gov (NCT05067140) A Phase 1/2 Open-Label, Dose-Escalation and Cohort Expansion Clinical Trial to Evaluate the Safety, Tolerability, Pharmacokinetics, and Pharmacodynamics of ARV-766 Monotherapy and in Combination With Abiraterone in Patients With Metastatic Prostate Cancer. U.S.National Institutes of Health. | |||||
| REF 41 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800039208) | |||||
| REF 42 | ClinicalTrials.gov (NCT05241613) A Phase I Study to Evaluate Safety, Tolerability, PK, Pharmacodynamics, and Preliminary Anti-Tumor Activity of AC176 in Patients With Metastatic Castration Resistant Prostate Cancer Who Have Progressed on at Least Two Prior Systemic Therapies. U.S.National Institutes of Health. | |||||
| REF 43 | ClinicalTrials.gov (NCT01351688) An Open Label Prostate Cancer Study in Japanese Patients. U.S. National Institutes of Health. | |||||
| REF 44 | ClinicalTrials.gov (NCT04428788) Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Pharmacodynamics of CC-94676 in Subjects With Metastatic Castration-Resistant Prostate Cancer. U.S. National Institutes of Health. | |||||
| REF 45 | ClinicalTrials.gov (NCT02567773) Safety, Tolerability, Pharmacokinetic (PK), and Pharmacodynamic Study of GSK2881078 and Study to Evaluate the Effect of CYP3A4 Inhibition on PK of GSK2881078. | |||||
| REF 46 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 47 | ClinicalTrials.gov (NCT04421222) Oral EPI-7386 in Patients With Metastatic Castration-Resistant Prostate Cancer (EPI-7386). U.S. National Institutes of Health. | |||||
| REF 48 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027228) | |||||
| REF 49 | Testosterone buciclate (20 Aet-1) in hypogonadal men: pharmacokinetics and pharmacodynamics of the new long-acting androgen ester. J Clin Endocrinol Metab. 1992 Nov;75(5):1204-10. | |||||
| REF 50 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010426) | |||||
| REF 51 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010830) | |||||
| REF 52 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028305) | |||||
| REF 53 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018266) | |||||
| REF 54 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800036899) | |||||
| REF 55 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013541) | |||||
| REF 56 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020680) | |||||
| REF 57 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017332) | |||||
| REF 58 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800040072) | |||||
| REF 59 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018432) | |||||
| REF 60 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006840) | |||||
| REF 61 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009538) | |||||
| REF 62 | Androgen receptor overexpression induces tamoxifen resistance in human breast cancer cells. Breast Cancer Res Treat. 2010 May;121(1):1-11. | |||||
| REF 63 | Coactivator selective regulation of androgen receptor activity. Steroids. 2009 Aug;74(8):669-74. | |||||
| REF 64 | Endocrinological and pathological effects of anabolic-androgenic steroid in male rats. Endocr J. 2004 Aug;51(4):425-34. | |||||
| REF 65 | Effects of 5-fluorouracil and 2 alpha-methyldihydrotestosterone propionate on the growth of human breast carcinoma MCF-7 in vitro. Eur J Cancer Clin Oncol. 1983 Sep;19(9):1231-7. | |||||
| REF 66 | Relative binding affinity of anabolic-androgenic steroids: comparison of the binding to the androgen receptors in skeletal muscle and in prostate, ... Endocrinology. 1984 Jun;114(6):2100-6. | |||||
| REF 67 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
| REF 68 | Ouellet M, Percival MD: Effect of inhibitor time-dependency on selectivity towards cyclooxygenase isoforms. Biochem J. 1995 Feb 15;306 ( Pt 1):247-51. | |||||
| REF 69 | An orally active selective androgen receptor modulator is efficacious on bone, muscle, and sex function with reduced impact on prostate. Endocrinology. 2007 Jan;148(1):363-73. | |||||
| REF 70 | Endocrine-responsive pancreatic carcinoma: steroid binding and cytotoxicity studies in human tumor cell lines. Cancer Res. 1986 May;46(5):2276-81. | |||||
| REF 71 | Ectopic expression of the amino-terminal peptide of androgen receptor leads to androgen receptor dysfunction and inhibition of androgen receptor-mediated prostate cancer growth. Mol Cell Endocrinol. 2004 Feb 12;214(1-2):175-87. | |||||
| REF 72 | Androgen antagonistic effect of estramustine phosphate (EMP) metabolites on wild-type and mutated androgen receptor. Biochem Pharmacol. 1998 May 1;55(9):1427-33. | |||||
| REF 73 | Expression of androgen receptor on fibroblast and hepatocyte of rats after deep second-degree burn caused by scalding. Sichuan Da Xue Xue Bao Yi Xue Ban. 2005 May;36(3):362-4. | |||||
| REF 74 | CX3CR1 is expressed by prostate epithelial cells and androgens regulate the levels of CX3CL1/fractalkine in the bone marrow: potential role in prostate cancer bone tropism. Cancer Res. 2008 Mar 15;68(6):1715-22. | |||||
| REF 75 | The effect of oxandrolone treatment on human osteoblastic cells. J Burns Wounds. 2007 Mar 7;6:e4. | |||||
| REF 76 | Dehydroepiandrosterone, glucose-6-phosphate dehydrogenase, and longevity. Ageing Res Rev. 2004 Apr;3(2):171-87. | |||||
| REF 77 | Molecular mechanism of androgen action. Trends Endocrinol Metab. 1998 Oct 1;9(8):317-24. | |||||
| REF 78 | Complexities of androgen action. J Am Acad Dermatol. 2001 Sep;45(3 Suppl):S87-94. | |||||
| REF 79 | Inhibition of the dihydrotestosterone-activated androgen receptor by nuclear receptor corepressor. Mol Endocrinol. 2002 Jul;16(7):1492-501. | |||||
| REF 80 | Clinical pipeline report, company report or official report of Hinova Pharmaceuticals. | |||||
| REF 81 | Antiandrogenic steroidal sulfonyl heterocycles. Utility of electrostatic complementarity in defining bioisosteric sulfonyl heterocycles. J Med Chem. 1992 May 15;35(10):1663-70. | |||||
| REF 82 | New therapeutic approach to suppress castration-resistant prostate cancer using ASC-J9 via targeting androgen receptor in selective prostate cells. Am J Pathol. 2013 Feb;182(2):460-73. | |||||
| REF 83 | Anti-androgen receptor ASC-J9 versus anti-androgens MDV3100 (Enzalutamide) or Casodex (Bicalutamide) leads to opposite effects on prostate cancer metastasis via differential modulation of macrophage infiltration and STAT3-CCL2 signaling. Cell Death Dis. 2013 Aug 8;4:e764. | |||||
| REF 84 | Company report (Astrazeneca) | |||||
| REF 85 | Discovery of the selective androgen receptor modulator MK-0773 using a rational development strategy based on differential transcriptional requirements for androgenic anabolism versus reproductive physiology. J Biol Chem. 2010 May 28;285(22):17054-64. | |||||
| REF 86 | Evidence for a role of testosterone-androgen receptor interactions in mediating masculine sexual behavior in male rats. Endocrinology. 1989 Feb;124(2):618-26. | |||||
| REF 87 | Clinical pipeline report, company report or official report of Arvinas. | |||||
| REF 88 | Targeting estrogen receptor alpha for degradation with PROTACs: A promising approach to overcome endocrine resistance. Eur J Med Chem. 2020 Nov 15;206:112689. | |||||
| REF 89 | Clinical pipeline report, company report or official report of Arvinas | |||||
| REF 90 | Preclinical Development of ONC1-13B, Novel Antiandrogen for Prostate Cancer Treatment. J Cancer. 2014 Jan 21;5(2):133-42. | |||||
| REF 91 | Clinical pipeline report, company report or official report of Accutar Biotechnology | |||||
| REF 92 | AZD3514: a small molecule that modulates androgen receptor signaling and function in vitro and in vivo. Mol Cancer Ther. 2013 Sep;12(9):1715-27. | |||||
| REF 93 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800039743) | |||||
| REF 94 | Clinical pipeline report, company report or official report of ESSA Pharma. | |||||
| REF 95 | Selective androgen receptor modulators in preclinical and clinical development. Nucl Recept Signal. 2008; 6: e010. | |||||
| REF 96 | Design, Synthesis, and Preclinical Characterization of the Selective Androgen Receptor Modulator (SARM) RAD140. ACS Med Chem Lett. 2010 Dec 2;2(2):124-9. | |||||
| REF 97 | Dehydroepiandrosterone upregulates neural androgen receptor level and transcriptional activity. J Neurobiol. 2003 Nov;57(2):163-71. | |||||
| REF 98 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028305) | |||||
| REF 99 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800036899) | |||||
| REF 100 | Influence of testosterone and a novel SARM on gene expression in whole blood of Macaca fascicularis. J Steroid Biochem Mol Biol. 2009 Apr;114(3-5):167-73. | |||||
| REF 101 | Phase I clinical trail of PF-06260414 for treating cachexia. Pfizer Inc. | |||||
| REF 102 | GLPG0492, a novel selective androgen receptor modulator, improves muscle performance in the exercised-mdx mouse model of muscular dystrophy. Pharmacol Res. 2013 Jun;72:9-24. | |||||
| REF 103 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006840) | |||||
| REF 104 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009538) | |||||
| REF 105 | Identification of the brominated flame retardant 1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane as an androgen agonist. J Med Chem. 2006 Dec 14;49(25):7366-72. | |||||
| REF 106 | Discovery of indole-containing tetracycles as a new scaffold for androgen receptor ligands. Bioorg Med Chem Lett. 2006 Jun 15;16(12):3233-7. | |||||
| REF 107 | The ChEMBL database in 2017. Nucleic Acids Res. 2017 Jan 4;45(D1):D945-D954. | |||||
| REF 108 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
| REF 109 | MR appearance of intra-abdominal metastatic melanoma. Magn Reson Imaging. 1992;10(4):705-8. | |||||
| REF 110 | 17beta-hydroxy-5alpha-androst-1-en-3-one (1-testosterone) is a potent androgen with anabolic properties. Toxicol Lett. 2006 Aug 20;165(2):149-55. | |||||
| REF 111 | EPI-001 is a selective peroxisome proliferator-activated receptor-gamma modulator with inhibitory effects on androgen receptor expression and activity in prostate cancer. Oncotarget. 2015 Feb 28;6(6):3811-24. | |||||
| REF 112 | Selective androgen receptor modulators (SARMs) negatively regulate triple-negative breast cancer growth and epithelial:mesenchymal stem cell signaling. PLoS One. 2014 Jul 29;9(7):e103202. | |||||
| REF 113 | Clinical pipeline report, company report or official report of Hygeia Therapeutics. | |||||
| REF 114 | Antiandrogenic natural Diels--Alder-type adducts from Brosimum rubescens. J Nat Prod. 1997 Oct;60(10):997-1002. | |||||
| REF 115 | Design, synthesis, and pharmacological characterization of 4-[4, 4-dimethyl-3-(4-hydroxybutyl)-5-oxo-2-thioxo-1-imidazolidinyl]- 2-iodobenzonitrile... J Med Chem. 2000 Aug 24;43(17):3344-7. | |||||
| REF 116 | Clinical pipeline report, company report or official report of Progenics Pharmaceuticals Serometrix. | |||||
| REF 117 | Estetrol review: profile and potential clinical applications. Climacteric. 2008;11 Suppl 1:47-58. | |||||
| REF 118 | Comparison of crystal structures of human androgen receptor ligand-binding domain complexed with various agonists reveals molecular determinants responsible for binding affinity. Protein Sci. 2006 May;15(5):987-99. | |||||
| REF 119 | A surface on the androgen receptor that allosterically regulates coactivator binding. Proc Natl Acad Sci U S A. 2007 Oct 9;104(41):16074-9. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.