Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T13629
|
|||||
| Target Name |
PD-1-PD-L1 interaction (PD-1/PD-L1 PPI)
|
|||||
| Synonyms |
Programmed cell death 1/Programmed cell death 1 ligand 1 PPI
Click to Show/Hide
|
|||||
| Gene Name |
PDCD1-CD274
|
|||||
| Target Type |
Patented-recorded target
|
[1] | ||||
| Disease | [+] 4 Target-related Diseases | + | ||||
| 1 | Human immunodeficiency virus disease [ICD-11: 1C60-1C62] | |||||
| 2 | Inflammatory liver disease [ICD-11: DB97] | |||||
| 3 | Postoperative inflammation [ICD-11: 1A00-CA43] | |||||
| 4 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| Function |
The PD-1/PD-L1 axis is probably also important for immune evasion of B-cell lymphomas with a viral aetiology, including those associated with human immunodeficiency virus (HIV) and Epstein-Barr virus (EBV).
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEETMQIPQAPWPV VWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAP KAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAV ICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYAT IVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Patented Agent(s) | [+] 73 Patented Agents | + | ||||
| 1 | 1,2,4-oxadiazole derivative 4 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 2 | 1,2,4-oxadiazole derivative 5 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 3 | 1,2,4-oxadiazole derivative 6 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 4 | 1,2,4-oxadiazole derivative 7 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 5 | 1,3,4-oxadiazole derivative 3 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 6 | 1,3,4-oxadiazole derivative 4 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 7 | 1,3,4-oxadiazole derivative 5 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 8 | 1,3,4-oxadiazole derivative 6 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 9 | 1,3,4-thiadiazole derivative 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 10 | 1,3,4-thiadiazole derivative 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 11 | 1,3-dihydroxy phenyl derivative 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 12 | 1,3-dihydroxy phenyl derivative 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 13 | 3-substituted-1,2,4-oxadiazole derivative 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 14 | 3-substituted-1,2,4-oxadiazole derivative 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 15 | Aromatic acetylene derivative 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 16 | Aromatic ethylene derivative 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 17 | Benzyl phenyl ether derivative 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 18 | Benzyl phenyl ether derivative 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 19 | Biaryl compound 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 20 | Biaryl compound 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 21 | Bromo benzyl ether derivative 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 22 | Bromo benzyl ether derivative 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 23 | Cyclic peptidomimetic derivative 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 24 | Cyclic peptidomimetic derivative 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 25 | Cyclic peptidomimetic derivative 3 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 26 | Macrocycle derivative 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 27 | Macrocycle derivative 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 28 | Macrocycle derivative 3 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 29 | Macrocycle derivative 4 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 30 | Macrocycle derivative 5 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 31 | Macrocycle derivative 6 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 32 | Macrocycle derivative 7 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 33 | Macrocycle derivative 8 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 34 | Macrocycle derivative 9 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 35 | Macrocyclic peptide analog 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 36 | Macrocyclic peptide analog 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 37 | Macrocyclic peptide analog 3 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 38 | N-phenyl-pyridine-2-carboxamide derivative 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 39 | N-phenyl-pyridine-2-carboxamide derivative 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 40 | Peptide analog 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 41 | Peptide analog 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 42 | Peptide analog 3 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 43 | Peptide analog 4 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 44 | Peptide analog 5 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 45 | Peptide analog 6 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 46 | Phenylate derivative 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 47 | Phenylate derivative 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 48 | PMID30107136-Compound-Example11 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 49 | PMID30107136-Compound-Example12 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 50 | PMID30107136-Compound-Example13 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 51 | PMID30107136-Compound-Example14 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 52 | PMID30107136-Compound-Example3 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 53 | PMID30107136-Compound-Example4 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 54 | PMID30107136-Compound-Example41 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 55 | PMID30107136-Compound-Example42 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 56 | PMID30107136-Compound-Example43 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 57 | PMID30107136-Compound-Example44 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 58 | PMID30107136-Compound-Example45 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 59 | PMID30107136-Compound-Example46 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 60 | PMID30107136-Compound-Example47 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 61 | PMID30107136-Compound-Example48 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 62 | PMID30107136-Compound-Example49 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 63 | PMID30107136-Compound-Example50 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 64 | PMID30107136-Compound-Example51 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 65 | PMID30107136-Compound-Example52 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 66 | PMID30107136-Compound-Example53 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 67 | PMID30107136-Compound-Example54 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 68 | PMID30107136-Compound-Example57 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 69 | PMID30107136-Compound-Example58 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 70 | PMID30107136-Compound-Example59 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 71 | PMID30107136-Compound-Example60 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 72 | PMID30107136-Compound-Example7 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 73 | PMID30107136-Compound-Example8 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 97 Inhibitor drugs | + | ||||
| 1 | 1,2,4-oxadiazole derivative 4 | Drug Info | [1] | |||
| 2 | 1,2,4-oxadiazole derivative 5 | Drug Info | [1] | |||
| 3 | 1,2,4-oxadiazole derivative 6 | Drug Info | [1] | |||
| 4 | 1,2,4-oxadiazole derivative 7 | Drug Info | [1] | |||
| 5 | 1,3,4-oxadiazole derivative 3 | Drug Info | [1] | |||
| 6 | 1,3,4-oxadiazole derivative 4 | Drug Info | [1] | |||
| 7 | 1,3,4-oxadiazole derivative 5 | Drug Info | [1] | |||
| 8 | 1,3,4-oxadiazole derivative 6 | Drug Info | [1] | |||
| 9 | 1,3,4-thiadiazole derivative 1 | Drug Info | [1] | |||
| 10 | 1,3,4-thiadiazole derivative 2 | Drug Info | [1] | |||
| 11 | 1,3-dihydroxy phenyl derivative 1 | Drug Info | [1] | |||
| 12 | 1,3-dihydroxy phenyl derivative 2 | Drug Info | [1] | |||
| 13 | 3-substituted-1,2,4-oxadiazole derivative 1 | Drug Info | [1] | |||
| 14 | 3-substituted-1,2,4-oxadiazole derivative 2 | Drug Info | [1] | |||
| 15 | Aromatic acetylene derivative 1 | Drug Info | [1] | |||
| 16 | Aromatic ethylene derivative 1 | Drug Info | [1] | |||
| 17 | Benzyl phenyl ether derivative 1 | Drug Info | [1] | |||
| 18 | Benzyl phenyl ether derivative 2 | Drug Info | [1] | |||
| 19 | Biaryl compound 1 | Drug Info | [1] | |||
| 20 | Biaryl compound 2 | Drug Info | [1] | |||
| 21 | Bromo benzyl ether derivative 1 | Drug Info | [1] | |||
| 22 | Bromo benzyl ether derivative 2 | Drug Info | [1] | |||
| 23 | Cyclic peptidomimetic derivative 1 | Drug Info | [1] | |||
| 24 | Cyclic peptidomimetic derivative 2 | Drug Info | [1] | |||
| 25 | Cyclic peptidomimetic derivative 3 | Drug Info | [1] | |||
| 26 | Macrocycle derivative 1 | Drug Info | [1] | |||
| 27 | Macrocycle derivative 2 | Drug Info | [1] | |||
| 28 | Macrocycle derivative 3 | Drug Info | [1] | |||
| 29 | Macrocycle derivative 4 | Drug Info | [1] | |||
| 30 | Macrocycle derivative 5 | Drug Info | [1] | |||
| 31 | Macrocycle derivative 6 | Drug Info | [1] | |||
| 32 | Macrocycle derivative 7 | Drug Info | [1] | |||
| 33 | Macrocycle derivative 8 | Drug Info | [1] | |||
| 34 | Macrocycle derivative 9 | Drug Info | [1] | |||
| 35 | Macrocyclic peptide analog 1 | Drug Info | [1] | |||
| 36 | Macrocyclic peptide analog 2 | Drug Info | [1] | |||
| 37 | Macrocyclic peptide analog 3 | Drug Info | [1] | |||
| 38 | N-phenyl-pyridine-2-carboxamide derivative 1 | Drug Info | [1] | |||
| 39 | N-phenyl-pyridine-2-carboxamide derivative 2 | Drug Info | [1] | |||
| 40 | Peptide analog 1 | Drug Info | [1] | |||
| 41 | Peptide analog 2 | Drug Info | [1] | |||
| 42 | Peptide analog 3 | Drug Info | [1] | |||
| 43 | Peptide analog 4 | Drug Info | [1] | |||
| 44 | Peptide analog 5 | Drug Info | [1] | |||
| 45 | Peptide analog 6 | Drug Info | [1] | |||
| 46 | Phenylate derivative 1 | Drug Info | [1] | |||
| 47 | Phenylate derivative 2 | Drug Info | [1] | |||
| 48 | PMID30107136-Compound-Example11 | Drug Info | [1] | |||
| 49 | PMID30107136-Compound-Example12 | Drug Info | [1] | |||
| 50 | PMID30107136-Compound-Example13 | Drug Info | [1] | |||
| 51 | PMID30107136-Compound-Example14 | Drug Info | [1] | |||
| 52 | PMID30107136-Compound-Example3 | Drug Info | [1] | |||
| 53 | PMID30107136-Compound-Example4 | Drug Info | [1] | |||
| 54 | PMID30107136-Compound-Example41 | Drug Info | [1] | |||
| 55 | PMID30107136-Compound-Example42 | Drug Info | [1] | |||
| 56 | PMID30107136-Compound-Example43 | Drug Info | [1] | |||
| 57 | PMID30107136-Compound-Example44 | Drug Info | [1] | |||
| 58 | PMID30107136-Compound-Example45 | Drug Info | [1] | |||
| 59 | PMID30107136-Compound-Example46 | Drug Info | [1] | |||
| 60 | PMID30107136-Compound-Example47 | Drug Info | [1] | |||
| 61 | PMID30107136-Compound-Example48 | Drug Info | [1] | |||
| 62 | PMID30107136-Compound-Example49 | Drug Info | [1] | |||
| 63 | PMID30107136-Compound-Example50 | Drug Info | [1] | |||
| 64 | PMID30107136-Compound-Example51 | Drug Info | [1] | |||
| 65 | PMID30107136-Compound-Example52 | Drug Info | [1] | |||
| 66 | PMID30107136-Compound-Example53 | Drug Info | [1] | |||
| 67 | PMID30107136-Compound-Example54 | Drug Info | [1] | |||
| 68 | PMID30107136-Compound-Example57 | Drug Info | [1] | |||
| 69 | PMID30107136-Compound-Example58 | Drug Info | [1] | |||
| 70 | PMID30107136-Compound-Example59 | Drug Info | [1] | |||
| 71 | PMID30107136-Compound-Example60 | Drug Info | [1] | |||
| 72 | PMID30107136-Compound-Example7 | Drug Info | [1] | |||
| 73 | PMID30107136-Compound-Example8 | Drug Info | [1] | |||
| 74 | MAX-10129 | Drug Info | [2] | |||
| 75 | PMID30247903-Compound-General structure18 | Drug Info | [2] | |||
| 76 | PMID30247903-Compound-General structure19 | Drug Info | [2] | |||
| 77 | PMID30247903-Compound-General structure26 | Drug Info | [2] | |||
| 78 | PMID30247903-Compound-General structure27 | Drug Info | [2] | |||
| 79 | PMID30247903-Compound-General structure28 | Drug Info | [2] | |||
| 80 | PMID30247903-Compound-General structure29 | Drug Info | [2] | |||
| 81 | PMID30247903-Compound-General structure30 | Drug Info | [2] | |||
| 82 | PMID30247903-Compound-General structure31 | Drug Info | [2] | |||
| 83 | PMID30247903-Compound-General structure32 | Drug Info | [2] | |||
| 84 | PMID30247903-Compound-General structure33 | Drug Info | [2] | |||
| 85 | PMID30247903-Compound-General structure34 | Drug Info | [2] | |||
| 86 | PMID30247903-Compound-General structure35 | Drug Info | [2] | |||
| 87 | PMID30247903-Compound-General structure36 | Drug Info | [2] | |||
| 88 | PMID30247903-Compound-General structure37 | Drug Info | [2] | |||
| 89 | PMID30247903-Compound-General structure38 | Drug Info | [2] | |||
| 90 | PMID30247903-Compound-General structure39 | Drug Info | [2] | |||
| 91 | PMID30247903-Compound-General structure40 | Drug Info | [2] | |||
| 92 | PMID30247903-Compound-General structure41 | Drug Info | [2] | |||
| 93 | PMID30247903-Compound-General structure42 | Drug Info | [2] | |||
| 94 | PMID30247903-Compound-General structure43 | Drug Info | [2] | |||
| 95 | PMID30247903-Compound-General structure44 | Drug Info | [2] | |||
| 96 | PMID30247903-Compound-General structure45 | Drug Info | [2] | |||
| 97 | PMID30247903-Compound-General structure46 | Drug Info | [2] | |||
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | A patent review on PD-1/PD-L1 antagonists: small molecules, peptides, and macrocycles (2015-2018).Expert Opin Ther Pat. 2018 Sep;28(9):665-678. | |||||
| REF 2 | Development of Inhibitors of the Programmed Cell Death-1/Programmed Cell Death-Ligand 1 Signaling Pathway.J Med Chem. 2019 Feb 28;62(4):1715-1730. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.