Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T40016
(Former ID: TTDS00283)
|
|||||
| Target Name |
Glucocorticoid receptor (NR3C1)
|
|||||
| Synonyms |
Nuclear receptor subfamily 3 group C member 1; GRL; GR
|
|||||
| Gene Name |
NR3C1
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 11 Target-related Diseases | + | ||||
| 1 | Adaptive immunity immunodeficiency [ICD-11: 4A01] | |||||
| 2 | Allergic/hypersensitivity disorder [ICD-11: 4A80-4A8Z] | |||||
| 3 | Asthma [ICD-11: CA23] | |||||
| 4 | Chronic obstructive pulmonary disease [ICD-11: CA22] | |||||
| 5 | Cushing syndrome [ICD-11: 5A70] | |||||
| 6 | Muscular dystrophy [ICD-11: 8C70] | |||||
| 7 | Oesophagitis [ICD-11: DA24] | |||||
| 8 | Postoperative inflammation [ICD-11: 1A00-CA43] | |||||
| 9 | Rheumatoid arthritis [ICD-11: FA20] | |||||
| 10 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| 11 | Vasomotor/allergic rhinitis [ICD-11: CA08] | |||||
| Function |
Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling. Plays a role in rapid mRNA degradation by binding to the 5' UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth (By similarity).
Click to Show/Hide
|
|||||
| BioChemical Class |
Nuclear hormone receptor
|
|||||
| UniProt ID | ||||||
| Sequence |
MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| ADReCS ID | BADD_A00948 ; BADD_A02053 | |||||
| HIT2.0 ID | T47G3X | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 21 Approved Drugs | + | ||||
| 1 | Betamethasone | Drug Info | Approved | Inflammation | [2], [3] | |
| 2 | Betamethasone Benzoate | Drug Info | Approved | Inflammation | [4] | |
| 3 | Betamethasone Valerate | Drug Info | Approved | Dermatological disease | [4] | |
| 4 | Budesonide | Drug Info | Approved | Asthma | [5], [6] | |
| 5 | Deflazacort | Drug Info | Approved | Duchenne dystrophy | [4], [7], [8], [9] | |
| 6 | Dexamethasone | Drug Info | Approved | Rheumatoid arthritis | [10], [11] | |
| 7 | Dexamethasone sodium phosphate | Drug Info | Approved | Ataxia-telangiectasia | [12] | |
| 8 | Flunisolide | Drug Info | Approved | Allergic rhinitis | [13], [14] | |
| 9 | Fluocinolone Acetonide | Drug Info | Approved | Inflammation | [15], [16] | |
| 10 | Fluorometholone | Drug Info | Approved | Chronic obstructive pulmonary disease | [4] | |
| 11 | Fluticasone | Drug Info | Approved | Allergic rhinitis | [4] | |
| 12 | GW685698X | Drug Info | Approved | Asthma | [17], [18] | |
| 13 | Hydrocortamate | Drug Info | Approved | Inflammation | [19] | |
| 14 | Hydrocortisone | Drug Info | Approved | Inflammation | [20], [6] | |
| 15 | Meprednisone | Drug Info | Approved | Chronic obstructive pulmonary disease | [4] | |
| 16 | Methylprednisolone | Drug Info | Approved | Solid tumour/cancer | [4] | |
| 17 | Mifepristone | Drug Info | Approved | Cushing disease | [21], [22], [4] | |
| 18 | Mometasone | Drug Info | Approved | Skin allergy | [6] | |
| 19 | Prednisolone | Drug Info | Approved | Solid tumour/cancer | [4] | |
| 20 | Prednisone | Drug Info | Approved | Inflammation | [23], [11] | |
| 21 | Triamcinolone | Drug Info | Approved | Allergic rhinitis | [4] | |
| Clinical Trial Drug(s) | [+] 15 Clinical Trial Drugs | + | ||||
| 1 | CORT-125134 | Drug Info | Phase 3 | Cushing disease | [24] | |
| 2 | FST-201 | Drug Info | Phase 3 | Otitis externa | [25] | |
| 3 | Mapracorat | Drug Info | Phase 3 | Ocular disease | [26], [27] | |
| 4 | BAY 86-5044 | Drug Info | Phase 2 | Breast cancer | [28] | |
| 5 | DE-110 | Drug Info | Phase 2 | Xerophthalmia | [29] | |
| 6 | ETIPREDNOL DICLOACETATE | Drug Info | Phase 2 | Rhinitis | [30] | |
| 7 | GW-870086-X | Drug Info | Phase 2 | Asthma | [31], [32] | |
| 8 | GW-870086-X | Drug Info | Phase 2 | Atopic dermatitis | [31], [32] | |
| 9 | IONIS-GCCRRX | Drug Info | Phase 2 | Type-2 diabetes | [33] | |
| 10 | LAS-41002 | Drug Info | Phase 2 | Eczema | [34] | |
| 11 | ORG 34517/34850 | Drug Info | Phase 2 | Solid tumour/cancer | [35], [36] | |
| 12 | ORG-34517 | Drug Info | Phase 2 | Depression | [37] | |
| 13 | TPI-1020 | Drug Info | Phase 2 | Chronic obstructive pulmonary disease | [38] | |
| 14 | IBI-20089 | Drug Info | Phase 1 | Diabetic macular edema | [33] | |
| 15 | NCX-1015 | Drug Info | Phase 1 | Rheumatoid arthritis | [39] | |
| Discontinued Drug(s) | [+] 6 Discontinued Drugs | + | ||||
| 1 | AZD-5423 | Drug Info | Discontinued in Phase 2 | Chronic obstructive pulmonary disease | [40] | |
| 2 | GSK870086 | Drug Info | Discontinued in Phase 2 | Asthma | [41] | |
| 3 | NM-135 | Drug Info | Discontinued in Phase 2 | Dermatitis | [42] | |
| 4 | WC-3027 | Drug Info | Discontinued in Phase 2 | Chronic obstructive pulmonary disease | [43] | |
| 5 | PF-251802 | Drug Info | Discontinued in Phase 1 | Rheumatoid arthritis | [44] | |
| 6 | Org-34116 | Drug Info | Terminated | Anxiety disorder | [45] | |
| Mode of Action | [+] 5 Modes of Action | + | ||||
| Agonist | [+] 16 Agonist drugs | + | ||||
| 1 | Betamethasone | Drug Info | [46] | |||
| 2 | Dexamethasone | Drug Info | [49], [50] | |||
| 3 | Dexamethasone sodium phosphate | Drug Info | [51] | |||
| 4 | Flunisolide | Drug Info | [52] | |||
| 5 | GW685698X | Drug Info | [55] | |||
| 6 | Mometasone | Drug Info | [57] | |||
| 7 | Prednisone | Drug Info | [59] | |||
| 8 | FST-201 | Drug Info | [62] | |||
| 9 | Mapracorat | Drug Info | [63] | |||
| 10 | DE-110 | Drug Info | [65] | |||
| 11 | GW-870086-X | Drug Info | [67] | |||
| 12 | GW-870086-X | Drug Info | [67] | |||
| 13 | IBI-20089 | Drug Info | [33] | |||
| 14 | AZD-5423 | Drug Info | [72] | |||
| 15 | WC-3027 | Drug Info | [75] | |||
| 16 | PF-251802 | Drug Info | [76] | |||
| Modulator | [+] 16 Modulator drugs | + | ||||
| 1 | Betamethasone Benzoate | Drug Info | [47] | |||
| 2 | Betamethasone Valerate | Drug Info | [47] | |||
| 3 | Deflazacort | Drug Info | [47] | |||
| 4 | Fluocinolone Acetonide | Drug Info | [47] | |||
| 5 | Hydrocortamate | Drug Info | [47] | |||
| 6 | Hydrocortisone | Drug Info | [47] | |||
| 7 | Meprednisone | Drug Info | [47] | |||
| 8 | Methylprednisolone | Drug Info | [47] | |||
| 9 | Mifepristone | Drug Info | [56] | |||
| 10 | Prednisolone | Drug Info | [58] | |||
| 11 | Triamcinolone | Drug Info | [47] | |||
| 12 | ETIPREDNOL DICLOACETATE | Drug Info | [66] | |||
| 13 | LAS-41002 | Drug Info | [68] | |||
| 14 | NCX-1015 | Drug Info | [39] | |||
| 15 | GSK870086 | Drug Info | [73] | |||
| 16 | NM-135 | Drug Info | [74] | |||
| Antagonist | [+] 8 Antagonist drugs | + | ||||
| 1 | Budesonide | Drug Info | [1], [48] | |||
| 2 | Fluticasone | Drug Info | [48], [54] | |||
| 3 | CORT-125134 | Drug Info | [60], [61] | |||
| 4 | IONIS-GCCRRX | Drug Info | [33] | |||
| 5 | ORG 34517/34850 | Drug Info | [69] | |||
| 6 | ORG-34517 | Drug Info | [70] | |||
| 7 | TPI-1020 | Drug Info | [71] | |||
| 8 | Org-34116 | Drug Info | [77] | |||
| Binder | [+] 1 Binder drugs | + | ||||
| 1 | Fluorometholone | Drug Info | [53] | |||
| Inhibitor | [+] 3 Inhibitor drugs | + | ||||
| 1 | BAY 86-5044 | Drug Info | [64] | |||
| 2 | B-Octylglucoside | Drug Info | [78] | |||
| 3 | Hexane-1,6-Diol | Drug Info | [78] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Drug Resistance Mutation (DRM) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
| 1 | Neuroactive ligand-receptor interaction | |||||
| NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
| 1 | IL2 Signaling Pathway | |||||
| 2 | TCR Signaling Pathway | |||||
| PID Pathway | [+] 6 PID Pathways | + | ||||
| 1 | Regulation of nuclear SMAD2/3 signaling | |||||
| 2 | Signaling events mediated by HDAC Class II | |||||
| 3 | FOXA2 and FOXA3 transcription factor networks | |||||
| 4 | Glucocorticoid receptor regulatory network | |||||
| 5 | Regulation of Androgen receptor activity | |||||
| 6 | AP-1 transcription factor network | |||||
| Reactome | [+] 1 Reactome Pathways | + | ||||
| 1 | BMAL1:CLOCK,NPAS2 activates circadian gene expression | |||||
| WikiPathways | [+] 8 WikiPathways | + | ||||
| 1 | Serotonin Receptor 4/6/7 and NR3C Signaling | |||||
| 2 | SIDS Susceptibility Pathways | |||||
| 3 | Nuclear Receptors Meta-Pathway | |||||
| 4 | Endoderm Differentiation | |||||
| 5 | Hair Follicle Development: Cytodifferentiation (Part 3 of 3) | |||||
| 6 | Adipogenesis | |||||
| 7 | Circadian Clock | |||||
| 8 | Nuclear Receptors | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | PXR-mediated induction of human CYP3A4 and mouse Cyp3a11 by the glucocorticoid budesonide. Eur J Pharm Sci. 2009 Mar 2;36(4-5):565-71. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7061). | |||||
| REF 3 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 019137. | |||||
| REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7434). | |||||
| REF 6 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
| REF 7 | ClinicalTrials.gov (NCT01817322) Kidney Graft Function Under the Immunosuppression Strategies. U.S. National Institutes of Health. | |||||
| REF 8 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2018 | |||||
| REF 9 | 2017 FDA drug approvals.Nat Rev Drug Discov. 2018 Feb;17(2):81-85. | |||||
| REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3447). | |||||
| REF 11 | Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54. | |||||
| REF 12 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033526) | |||||
| REF 13 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7076). | |||||
| REF 14 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074805. | |||||
| REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7077). | |||||
| REF 16 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 019452. | |||||
| REF 17 | ClinicalTrials.gov (NCT00539006) Comparator Study Evaluating Patient Preference Of FFNS vs. FPNS. U.S. National Institutes of Health. | |||||
| REF 18 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 19 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010554. | |||||
| REF 20 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2868). | |||||
| REF 21 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2805). | |||||
| REF 22 | ClinicalTrials.gov (NCT02342002) Mifepristone and Misoprostol Versus Misoprostol Alone for Missed Abortion: A Randomized-controlled Trial. U.S. National Institutes of Health. | |||||
| REF 23 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7096). | |||||
| REF 24 | ClinicalTrials.gov (NCT03697109) A Study of the Efficacy and Safety of Relacorilant in Patients With Endogenous Cushing Syndrome (GRACE). U.S. National Institutes of Health. | |||||
| REF 25 | ClinicalTrials.gov (NCT00945646) FST-201 In The Treatment of Acute Fungal Otitis Externa. U.S. National Institutes of Health. | |||||
| REF 26 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8643). | |||||
| REF 27 | ClinicalTrials.gov (NCT01298752) Mapracorat Ophthalmic Suspension, 3% for the Treatment of Ocular Inflammation Following Cataract Surgery. U.S. National Institutes of Health. | |||||
| REF 28 | ClinicalTrials.gov (NCT00555919) ZK 230211 in Postmenopausal Woman With Metastatic Breast Cancer. U.S. National Institutes of Health. | |||||
| REF 29 | ClinicalTrials.gov (NCT01239069) Safety and Efficacy Study of DE-110 Ophthalmic Suspension for the Treatment of Dry Eye Disease. U.S. National Institutes of Health. | |||||
| REF 30 | ClinicalTrials.gov (NCT00035503) Multicenter Trial For Patients With Acute Crohn's Disease. U.S. National Institutes of Health. | |||||
| REF 31 | ClinicalTrials.gov (NCT01299610) A Study to Test the Effect of 2 Different Doses of Topical GW870086X on Atopic Dermatitis Also Including a Postive Control and a Placebo. U.S. National Institutes of Health. | |||||
| REF 32 | ClinicalTrials.gov (NCT00549497) A Randomized Study Evaluating Steroid Hormone Levels, Safety And Tolerability Of GW870086X In Healthy Volunteers. U.S. National Institutes of Health. | |||||
| REF 33 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 34 | ClinicalTrials.gov (NCT01119313) Study to Investigate Skin Conditions and Patient Assessment of LAS 41002 in the Treatment of Atopic Eczema. U.S. National Institutes of Health. | |||||
| REF 35 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5268). | |||||
| REF 36 | S-adenosylmethionine decarboxylase as an enzyme target for therapy. Pharmacol Ther. 1992 Dec;56(3):359-77. | |||||
| REF 37 | ClinicalTrials.gov (NCT00212797) A Study to Determine the Efficacy and Safety of 2 Doses of Org 34517 as Adjunctive Therapy in Subjects With Psychotic Major Depression (28130)(P05845). U.S. National Institutes of Health. | |||||
| REF 38 | ClinicalTrials.gov (NCT00483743) Safety, Tolerability and PD Activity of Inhaled TPI 1020 Versus Inhaled Budesonide in COPD Patients. U.S. National Institutes of Health. | |||||
| REF 39 | Glucocorticoid receptor nitration leads to enhanced anti-inflammatory effects of novel steroid ligands. J Immunol. 2003 Sep 15;171(6):3245-52. | |||||
| REF 40 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031497) | |||||
| REF 41 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024246) | |||||
| REF 42 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011462) | |||||
| REF 43 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021444) | |||||
| REF 44 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029003) | |||||
| REF 45 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011369) | |||||
| REF 46 | The cannabinoid CB2 receptor inverse agonist JTE-907 suppresses spontaneous itch-associated responses of NC mice, a model of atopic dermatitis. Eur J Pharmacol. 2006 Aug 7;542(1-3):179-83. | |||||
| REF 47 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
| REF 48 | Knockouts model the 100 best-selling drugs--will they model the next 100 Nat Rev Drug Discov. 2003 Jan;2(1):38-51. | |||||
| REF 49 | Interaction between the glucocorticoid and erythropoietin receptors in human erythroid cells. Exp Hematol. 2009 May;37(5):559-72. | |||||
| REF 50 | Functional mineralocorticoid receptor (MR) gene variation influences the cortisol awakening response after dexamethasone. Psychoneuroendocrinology. 2010 Apr;35(3):339-49. | |||||
| REF 51 | Dexamethasone rapidly increases GABA release in the dorsal motor nucleus of the vagus via retrograde messenger-mediated enhancement of TRPV1 activity. PLoS One. 2013 Jul 30;8(7):e70505. | |||||
| REF 52 | The glucocorticoid receptor heterocomplex gene STIP1 is associated with improved lung function in asthmatic subjects treated with inhaled corticost... J Allergy Clin Immunol. 2009 Jun;123(6):1376-83.e7. | |||||
| REF 53 | Loteprednol etabonate: a soft steroid for the treatment of allergic diseases of the airways. Drugs Today (Barc). 2000 May;36(5):313-20. | |||||
| REF 54 | Fluticasone furoate nasal spray in allergic rhinitis. Drugs Today (Barc). 2008 Apr;44(4):251-60. | |||||
| REF 55 | Clinical pipeline report, company report or official report of GlaxoSmithKline (2009). | |||||
| REF 56 | The glucocorticoid agonist activities of mifepristone (RU486) and progesterone are dependent on glucocorticoid receptor levels but not on EC50 values. Steroids. 2007 Jun;72(6-7):600-8. | |||||
| REF 57 | Mometasone furoate is a less specific glucocorticoid than fluticasone propionate. Eur Respir J. 2002 Dec;20(6):1386-92. | |||||
| REF 58 | Aldosterone (mineralocorticoid) equivalent to prednisolone (glucocorticoid) in reversing hearing loss in MRL/MpJ-Fas1pr autoimmune mice. Laryngoscope. 2000 Nov;110(11):1902-6. | |||||
| REF 59 | Cytochromes P450 (CYP) in the Poeciliopsis lucida hepatocellular carcinoma cell line (PLHC-1): dose- and time-dependent glucocorticoid potentiation of CYP1A induction without induction of CYP3A. ArchBiochem Biophys. 1996 May 1;329(1):113-22. | |||||
| REF 60 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 61 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 62 | A combination povidone-iodine 0.4%/dexamethasone 0.1% ophthalmic suspension in the treatment of adenoviral conjunctivitis. Adv Ther. 2009 Aug;26(8):776-83. | |||||
| REF 63 | Characterization of ZK 245186, a novel, selective glucocorticoid receptor agonist for the topical treatment of inflammatory skin diseases. Br J Pharmacol. 2009 Oct;158(4):1088-103. | |||||
| REF 64 | Synthesis and biological activity of a novel, highly potent progesterone receptor antagonist. J Med Chem. 2000 Dec 28;43(26):5010-6. | |||||
| REF 65 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031667) | |||||
| REF 66 | Advances in corticosteroid therapy for ocular inflammation: loteprednol etabonate.Int J Inflam.2012;2012:789623. | |||||
| REF 67 | Unique response profile of trabecular meshwork cells to the novel selective glucocorticoid receptor agonist, GW870086X. Invest Ophthalmol Vis Sci. 2013 Mar 1;54(3):2100-7. | |||||
| REF 68 | Barrier-Restoring Therapies in Atopic Dermatitis: Current Approaches and Future Perspectives. Dermatol Res Pract. 2012; 2012: 923134. | |||||
| REF 69 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. | |||||
| REF 70 | Differential effects of the new glucocorticoid receptor antagonist ORG 34517 and RU486 (mifepristone) on glucocorticoid receptor nuclear translocation in the AtT20 cell line. Ann N Y Acad Sci. 2008 Dec;1148:536-41. | |||||
| REF 71 | Bronchoprotection in conscious guinea pigs by budesonide and the NO-donating analogue, TPI 1020, alone and combined with tiotropium or formoterol. Br J Pharmacol. 2012 Oct;167(3):515-26. | |||||
| REF 72 | A nonsteroidal glucocorticoid receptor agonist inhibits allergen-induced late asthmatic responses. Am J Respir Crit Care Med. 2015 Jan 15;191(2):161-7. | |||||
| REF 73 | CN patent application no. 102388025, Pyrimidopyridazine derivatives useful as p38 mapk inhibitors. | |||||
| REF 74 | Local anti-inflammatory activity and systemic side effects of NM-135, a new prodrug glucocorticoid, in an experimental inflammatory rat model. Jpn J Pharmacol. 1998 Dec;78(4):505-9. | |||||
| REF 75 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021444) | |||||
| REF 76 | Glucocorticoids Pharmacology: Past, Present and Future. Current Pharmaceutical Design. VOLUME 16, ISSUE 32, Page(3540-3553), DOI: 10.2174/138161210793797915. | |||||
| REF 77 | Blockade of glucocorticoid receptors with ORG 34116 does not normalize stress-induced symptoms in male tree shrews. Eur J Pharmacol. 2002 Dec 20;457(2-3):207-16. | |||||
| REF 78 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.