Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T75498
(Former ID: TTDC00138)
|
|||||
| Target Name |
Quinone reductase 2 (NQO2)
|
|||||
| Synonyms |
Quinone oxidoreductase 2; Qui reductase 2; QR2; NRH:quinone oxidoreductase 2; NRH:qui oxidoreductase 2; NQO2; NAD(P)H qui oxidoreductase 2
|
|||||
| Gene Name |
NQO2
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Insomnia [ICD-11: 7A00-7A0Z] | |||||
| Function |
The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
Click to Show/Hide
|
|||||
| BioChemical Class |
Diphenol donor oxidoreductase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 1.10.5.1
|
|||||
| Sequence |
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| HIT2.0 ID | T28WZ9 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Melatonin | Drug Info | Approved | Insomnia | [2], [3], [4] | |
| Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
| 1 | NSC-645809 | Drug Info | Phase 2 | Breast cancer | [5] | |
| 2 | Prolarix | Drug Info | Phase 2 | Solid tumour/cancer | [6] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | CB1954 | Drug Info | Discontinued in Phase 2 | Solid tumour/cancer | [7] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 69 Inhibitor drugs | + | ||||
| 1 | Melatonin | Drug Info | [1] | |||
| 2 | NSC-645809 | Drug Info | [8] | |||
| 3 | Prolarix | Drug Info | [9] | |||
| 4 | CB1954 | Drug Info | [10] | |||
| 5 | 1,4-Dimethylquinolin-2(1H)-one | Drug Info | [11] | |||
| 6 | 10-Propargyl-5,8-Dideazafolic Acid | Drug Info | [10] | |||
| 7 | 2-iodo-melatonin | Drug Info | [11] | |||
| 8 | 3,4,5-Trimethoxy-4'-amino-trans-stilbene | Drug Info | [12] | |||
| 9 | 3,5-Dimethoxy-4'-amino-trans-stilbene | Drug Info | [12] | |||
| 10 | 5,6,8-Trimethoxy-1,4-dimethylquinolin-2(1H)-one | Drug Info | [11] | |||
| 11 | 5,6,8-Trimethoxy-4-methylquinolin-2(1H)-one | Drug Info | [11] | |||
| 12 | 5,8-dimethoxy-1,4-dimethylquinolin-2(1H)-one | Drug Info | [1] | |||
| 13 | 5,8-Dimethoxy-4-methylquinolin-2(1H)-one | Drug Info | [11] | |||
| 14 | 6,7,8-Trimethoxy-1,4-dimethylquinolin-2(1H)-one | Drug Info | [11] | |||
| 15 | 6,7,8-Trimethoxy-4-methylquinolin-2(1H)-one | Drug Info | [11] | |||
| 16 | 6,8-Dimethoxy-1,4-dimethylquinolin-2(1H)-one | Drug Info | [11] | |||
| 17 | 6,8-Dimethoxy-4-methylquinolin-2(1H)-one | Drug Info | [11] | |||
| 18 | 6-Methyl-[1,3]dioxolo[4,5-h]quinolin-8(9H)-one | Drug Info | [11] | |||
| 19 | 7,8-Dimethoxy-1,4-dimethylquinolin-2(1H)-one | Drug Info | [11] | |||
| 20 | 8-Methoxy-1,4-dimethylquinolin-2(1H)-one | Drug Info | [11] | |||
| 21 | decynium 22 | Drug Info | [13] | |||
| 22 | Flavin-Adenine Dinucleotide | Drug Info | [10] | |||
| 23 | NSC-106080 | Drug Info | [13] | |||
| 24 | NSC-115890 | Drug Info | [13] | |||
| 25 | NSC-180969 | Drug Info | [13] | |||
| 26 | NSC-204996 | Drug Info | [13] | |||
| 27 | NSC-238146 | Drug Info | [13] | |||
| 28 | NSC-300853 | Drug Info | [13] | |||
| 29 | NSC-306843 | Drug Info | [13] | |||
| 30 | NSC-356819 | Drug Info | [13] | |||
| 31 | NSC-356820 | Drug Info | [13] | |||
| 32 | NSC-359466 | Drug Info | [13] | |||
| 33 | NSC-381864 | Drug Info | [13] | |||
| 34 | NSC-637991 | Drug Info | [8] | |||
| 35 | NSC-637992 | Drug Info | [8] | |||
| 36 | NSC-637993 | Drug Info | [8] | |||
| 37 | NSC-637994 | Drug Info | [8] | |||
| 38 | NSC-640353 | Drug Info | [13] | |||
| 39 | NSC-640556 | Drug Info | [13] | |||
| 40 | NSC-640558 | Drug Info | [13] | |||
| 41 | NSC-640559 | Drug Info | [13] | |||
| 42 | NSC-640566 | Drug Info | [13] | |||
| 43 | NSC-640583 | Drug Info | [13] | |||
| 44 | NSC-640584 | Drug Info | [13] | |||
| 45 | NSC-645808 | Drug Info | [8] | |||
| 46 | NSC-645811 | Drug Info | [8] | |||
| 47 | NSC-645812 | Drug Info | [8] | |||
| 48 | NSC-645831 | Drug Info | [8] | |||
| 49 | NSC-645833 | Drug Info | [8] | |||
| 50 | NSC-645834 | Drug Info | [8] | |||
| 51 | NSC-645835 | Drug Info | [8] | |||
| 52 | NSC-645836 | Drug Info | [8] | |||
| 53 | NSC-649091 | Drug Info | [13] | |||
| 54 | NSC-660838 | Drug Info | [8] | |||
| 55 | NSC-660839 | Drug Info | [8] | |||
| 56 | NSC-660840 | Drug Info | [8] | |||
| 57 | NSC-660841 | Drug Info | [8] | |||
| 58 | NSC-665126 | Drug Info | [13] | |||
| 59 | NSC-669977 | Drug Info | [13] | |||
| 60 | NSC-676468 | Drug Info | [13] | |||
| 61 | NSC-677939 | Drug Info | [13] | |||
| 62 | NSC-693571 | Drug Info | [13] | |||
| 63 | NSC-720622 | Drug Info | [13] | |||
| 64 | NSC-77833 | Drug Info | [13] | |||
| 65 | NSC-78017 | Drug Info | [13] | |||
| 66 | NSC-78021 | Drug Info | [13] | |||
| 67 | NSC-86715 | Drug Info | [13] | |||
| 68 | NSC-99495 | Drug Info | [13] | |||
| 69 | NSC-99528 | Drug Info | [13] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 224). | |||||
| REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 4 | Melatonin and melatonergic drugs on sleep: possible mechanisms of action. Int J Neurosci. 2009;119(6):821-46. | |||||
| REF 5 | Role of human UDP-glucuronosyltransferases in the biotransformation of the triazoloacridinone and imidazoacridinone antitumor agents C-1305 and C-1311: highly selective substrates for UGT1A10. Drug Metab Dispos. 2012 Sep;40(9):1736-43. | |||||
| REF 6 | ClinicalTrials.gov (NCT00746590) Study of Anti-tumour Effects and Safety of Prolarix in Hepatocellular Carcinoma. U.S. National Institutes of Health. | |||||
| REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019051) | |||||
| REF 8 | Imidazoacridin-6-ones as novel inhibitors of the quinone oxidoreductase NQO2. Bioorg Med Chem Lett. 2010 May 1;20(9):2832-6. | |||||
| REF 9 | CenterWatch. Drugs in Clinical Trials Database. CenterWatch. 2008. | |||||
| REF 10 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
| REF 11 | Synthesis of casimiroin and optimization of its quinone reductase 2 and aromatase inhibitory activities. J Med Chem. 2009 Apr 9;52(7):1873-84. | |||||
| REF 12 | Design, synthesis, and biological evaluation of resveratrol analogues as aromatase and quinone reductase 2 inhibitors for chemoprevention of cancer. Bioorg Med Chem. 2010 Jul 15;18(14):5352-66. | |||||
| REF 13 | In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.