Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T81100
(Former ID: TTDC00336)
|
|||||
| Target Name |
SLC5A2 messenger RNA (SLC5A2 mRNA)
|
|||||
| Synonyms |
Solute carrier family 5 member 2 (mRNA); Na(+)/glucose cotransporter 2 (mRNA); Low affinity sodium-glucose cotransporter (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
SLC5A2
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
| Function |
Has a Na(+) to glucose coupling ratio of 1:1. Sodium-dependent glucose transporter.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| Sequence |
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM MAVAVFLWGFYA Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Bexagliflozin | Drug Info | Approved | Type 2 diabetes | [2] | |
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | ISIS-SGLT2 | Drug Info | Phase 1 | Type-2 diabetes | [3] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 16 Inhibitor drugs | + | ||||
| 1 | Bexagliflozin | Drug Info | [1] | |||
| 2 | 10-methoxy-N(1)-methylburnamine-17-O-veratrate | Drug Info | [4] | |||
| 3 | ACEROGENIN B | Drug Info | [5] | |||
| 4 | Acerogenin C | Drug Info | [5] | |||
| 5 | Alstiphyllanine D | Drug Info | [4] | |||
| 6 | Alstiphyllanine E | Drug Info | [4] | |||
| 7 | Alstiphyllanine F | Drug Info | [4] | |||
| 8 | Burnamine-17-O-3',4',5'-trimethoxybenzoate | Drug Info | [4] | |||
| 9 | FORMONONETIN | Drug Info | [6] | |||
| 10 | KURAIDIN | Drug Info | [6] | |||
| 11 | KURARINONE | Drug Info | [6] | |||
| 12 | Kushenol N | Drug Info | [6] | |||
| 13 | MAACKIAIN | Drug Info | [6] | |||
| 14 | O-spiroketal glucoside | Drug Info | [7] | |||
| 15 | SERGLIFLOZIN A | Drug Info | [8] | |||
| 16 | Sophoraflavanone G | Drug Info | [6] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| Reactome | [+] 3 Reactome Pathways | + | ||||
| 1 | Hexose transport | |||||
| 2 | Na+-dependent glucose transporters | |||||
| 3 | Inositol transporters | |||||
| WikiPathways | [+] 2 WikiPathways | + | ||||
| 1 | NRF2 pathway | |||||
| 2 | Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 2 | FDA Approved Drug Products from FDA Official Website. 2023. Application Number: 214373. | |||||
| REF 3 | Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2011). | |||||
| REF 4 | Alstiphyllanines E-H, picraline and ajmaline-type alkaloids from Alstonia macrophylla inhibiting sodium glucose cotransporter. Bioorg Med Chem. 2010 Mar 15;18(6):2152-2158. | |||||
| REF 5 | Cyclic diarylheptanoids as Na+-glucose cotransporter (SGLT) inhibitors from Acer nikoense. Bioorg Med Chem Lett. 2010 Feb 1;20(3):1070-4. | |||||
| REF 6 | Na+-glucose cotransporter (SGLT) inhibitory flavonoids from the roots of Sophora flavescens. Bioorg Med Chem. 2007 May 15;15(10):3445-9. | |||||
| REF 7 | ortho-Substituted C-aryl glucosides as highly potent and selective renal sodium-dependent glucose co-transporter 2 (SGLT2) inhibitors. Bioorg Med Chem. 2010 Jun 15;18(12):4422-32. | |||||
| REF 8 | Novel C-aryl glucoside SGLT2 inhibitors as potential antidiabetic agents: 1,3,4-Thiadiazolylmethylphenyl glucoside congeners. Bioorg Med Chem. 2010 Mar 15;18(6):2178-2194. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.