Target Information

Target General Infomation
Target ID
T02808
Former ID
TTDI01922
Target Name
Interferon beta ligand
Gene Name
IFNB1
Synonyms
Fibroblast interferon; IFNbeta; Interferon beta; IFNB1
Target Type
Successful
Disease Autoimmune diabetes [ICD10: E08-E13]
Acute lung injury [ICD9: 518; ICD10: J80]
Glioblastoma multiforme [ICD9: 191; ICD10: C71]
Multiple scierosis [ICD9: 340; ICD10: G35]
Type 2 diabetes [ICD9: 250; ICD10: E11]
Unspecified [ICD code not available]
Function
Has antiviral, antibacterial and anticancer activities.
BioChemical Class
Cytokine: interferon
UniProt ID
P01574
Sequence
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
LTGYLRN
Drugs and Mode of Action
Drug(s) Interferon beta-1a Drug Info Approved Multiple scierosis [536361], [543077]
PEGylated IFN beta 1-a Drug Info Approved Type 2 diabetes [524908], [532764]
PLEGRIDY Drug Info Approved Multiple scierosis [533123], [542620]
Biferonex Drug Info Phase 3 Multiple scierosis [530175]
FP-1201 Drug Info Phase 3 Acute lung injury [550650]
NU-100 Drug Info Phase 3 Multiple scierosis [523679]
AZ-01, PEGylated interferon-beta Drug Info Phase 2 Multiple scierosis [550228]
Interferon beta 1a inhalation - Synairgen Drug Info Phase 2 Unspecified [1572591]
ARX-424 Drug Info Phase 1 Multiple scierosis [549740]
Gene therapy, IFN-b Drug Info Phase 1 Glioblastoma multiforme [529271]
TV-1390 Drug Info Preclinical Multiple scierosis [549145]
Maxy-10 Drug Info Terminated Autoimmune diabetes [547427]
Modulator ARX-424 Drug Info [544317]
AZ-01, PEGylated interferon-beta Drug Info [544317]
Biferonex Drug Info [530175]
FP-1201 Drug Info
Gene therapy, IFN-b Drug Info [527290]
Interferon beta 1a inhalation - Synairgen Drug Info [1572591]
Interferon beta-1a Drug Info [556264]
Maxy-10 Drug Info [551925]
NU-100 Drug Info [544317]
Peginterferon beta - Toray Industries Drug Info
PEGylated IFN beta 1-a Drug Info [532764]
PLEGRIDY Drug Info [533123]
TV-1390 Drug Info [549146]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Chagas disease (American trypanosomiasis)
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
NetPath Pathway TNFalpha Signaling Pathway
PANTHER Pathway Toll receptor signaling pathway
Pathway Interaction Database Regulation of nuclear SMAD2/3 signaling
Reactome Oxidative Stress Induced Senescence
Interferon alpha/beta signaling
Regulation of IFNA signaling
TRAF3-dependent IRF activation pathway
TRAF6 mediated IRF7 activation
Factors involved in megakaryocyte development and platelet production
WikiPathways Toll-like receptor signaling pathway
Type II interferon signaling (IFNG)
Senescence and Autophagy in Cancer
Cytokines and Inflammatory Response
EBV LMP1 signaling
RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways
Interferon alpha/beta signaling
Regulation of toll-like receptor signaling pathway
Osteoclast Signaling
References
Ref 523679ClinicalTrials.gov (NCT01464905) Phase 3 Study to Evaluate Efficacy and Safety of NU100 in Patients With Relapsing Remitting Multiple Sclerosis (RRMS). U.S. National Institutes of Health.
Ref 524908ClinicalTrials.gov (NCT02234869) Transition to Peginterferon Beta-1a (BIIB017) From Subcutaneous Interferon Therapy. U.S. National Institutes of Health.
Ref 529271A phase I clinical trial of interferon-beta gene therapy for high-grade glioma: novel findings from gene expression profiling and autopsy. J Gene Med. 2008 Apr;10(4):329-39.
Ref 530175Improving compliance with interferon-beta therapy in patients with multiple sclerosis. CNS Drugs. 2009;23(6):453-62.
Ref 532764Pegylated interferon beta-1a for relapsing-remitting multiple sclerosis (ADVANCE): a randomised, phase 3, double-blind study. Lancet Neurol. 2014 Jul;13(7):657-65.
Ref 5331232014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 542620(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7637).
Ref 543077(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8339).
Ref 547427Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016147)
Ref 549145Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032947)
Ref 549740Clinical pipeline report, company report or official report of Merck Serono.
Ref 550228Clinical pipeline report, company report or official report of Allozyne Inc.
Ref 550650Clinical pipeline report, company report or official report of Faron Pharmaceuticals.
Ref 1572591Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
Ref
Ref 527290Interferon-beta gene therapy for cancer: basic research to clinical application. Cancer Sci. 2004 Nov;95(11):858-65.
Ref 530175Improving compliance with interferon-beta therapy in patients with multiple sclerosis. CNS Drugs. 2009;23(6):453-62.
Ref 532764Pegylated interferon beta-1a for relapsing-remitting multiple sclerosis (ADVANCE): a randomised, phase 3, double-blind study. Lancet Neurol. 2014 Jul;13(7):657-65.
Ref 5331232014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
Ref 544317PEGylated interferon beta-1a in the treatment of multiple sclerosis - an update. Biologics. 2013; 7: 131-138.
Ref 549146Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032947)
Ref 551925US patent application no. 8,669,257, Phenazine derivatives and uses thereof as potassium channel modulators.
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
Ref 1572591Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.