Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T16688
|
||||
Former ID |
TTDS00466
|
||||
Target Name |
Diglyceride acyltransferase
|
||||
Gene Name |
DGAT1
|
||||
Synonyms |
ACAT-related gene product 1; AGRP1; DGAT; Diacylglycerol O-acyltransferase 1; DGAT1
|
||||
Target Type |
Successful
|
||||
Disease | Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | ||||
Familial chylomicronemia syndrome; HCV infection [ICD9:070.4, 070.5, 070.70; ICD10: J10, J11, B17.1, B18.2] | |||||
High cholesterol level [ICD9: 272; ICD10: E78.0] | |||||
Obesity; Diabetes [ICD9: 250, 278; ICD10: E08-E13, E66] | |||||
Obesity [ICD9: 278; ICD10: E66] | |||||
Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
Function |
Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
|
||||
BioChemical Class |
Acyltransferase
|
||||
UniProt ID | |||||
EC Number |
EC 2.3.1.76
|
||||
Sequence |
MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVG
SGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQV VSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPA AVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHT VSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM VPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREF YRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVS VPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLN YEAPAAEA |
||||
Drugs and Mode of Action | |||||
Drug(s) | Hesperetin | Drug Info | Approved | High cholesterol level | [1] |
LCQ908 | Drug Info | Phase 3 | Familial chylomicronemia syndrome; HCV infection | [2], [3] | |
AZD7687 | Drug Info | Phase 1 | Obesity; Diabetes | [4], [5] | |
P-7435 | Drug Info | Phase 1 | Diabetes | [6] | |
DS-7250 | Drug Info | Discontinued in Phase 1 | Diabetes | [7] | |
JTT-553 | Drug Info | Discontinued in Phase 1 | Obesity | [8] | |
PF-04620110 | Drug Info | Terminated | Type 2 diabetes | [9], [10] | |
Inhibitor | AZD7687 | Drug Info | [5] | ||
Hesperetin | Drug Info | [11] | |||
JTT-553 | Drug Info | [12] | |||
P-7435 | Drug Info | [13] | |||
PF-04620110 | Drug Info | [10] | |||
Modulator | DS-7250 | Drug Info | [14] | ||
LCQ908 | Drug Info | [15] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Triacylglycerol biosynthesis | ||||
KEGG Pathway | Glycerolipid metabolism | ||||
Retinol metabolism | |||||
Metabolic pathways | |||||
Fat digestion and absorption | |||||
PathWhiz Pathway | Retinol Metabolism | ||||
Reactome | Acyl chain remodeling of DAG and TAG | ||||
Triglyceride Biosynthesis | |||||
WikiPathways | Vitamin A and Carotenoid Metabolism | ||||
Statin Pathway | |||||
Triacylglyceride Synthesis | |||||
Glycerophospholipid biosynthesis | |||||
Fatty acid, triacylglycerol, and ketone body metabolism | |||||
References | |||||
REF 1 | Drug information of Hesperetin, 2008. eduDrugs. | ||||
REF 2 | ClinicalTrials.gov (NCT01514461) A Randomized, Double-blind, Placebo Controlled Study to Assess Efficacy, Safety and Tolerability of LCQ908 in Subjects With Familial Chylomicronemia Syndrome. U.S. National Institutes of Health. | ||||
REF 3 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7830). | ||||
REF 4 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7827). | ||||
REF 5 | Clinical pipeline report, company report or official report of AstraZeneca (2011). | ||||
REF 6 | ClinicalTrials.gov (NCT01764425) Clinical Trial to Study the Safety Tolerability, Pharmacokinetics, Food Effect & Pharmacodynamics of a New Compound P7435 in Healthy, Overweight and/or Obese Subjects. U.S. National Institutes of Health. | ||||
REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035670) | ||||
REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026874) | ||||
REF 9 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7829). | ||||
REF 10 | Clinical pipeline report, company report or official report of Pfizer (2011). | ||||
REF 11 | In vitro inhibition of diacylglycerol acyltransferase by prenylflavonoids from Sophora flavescens. Planta Med. 2004 Mar;70(3):258-60. | ||||
REF 12 | JTT-553, a novel Acyl CoA:diacylglycerol acyltransferase (DGAT) 1 inhibitor, improves glucose metabolism in diet-induced obesity and genetic T2DM mice. J Pharmacol Sci. 2015 Sep;129(1):51-8. | ||||
REF 13 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033014) | ||||
REF 14 | Clinical pipeline report, company report or official report of Daiichi Sankyo. | ||||
REF 15 | DGAT1 inhibitors as anti-obesity and anti-diabetic agents. Curr Opin Drug Discov Devel. 2010 Jul;13(4):489-96. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.