Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T44771
|
||||
| Former ID |
TTDI02306
|
||||
| Target Name |
mRNA of TGF beta-2 ligand
|
||||
| Gene Name |
TGFB2
|
||||
| Synonyms |
BSC-1 cell growth inhibitor (mRNA); Cetermin (mRNA); G-TSF (mRNA); Glioblastoma-derived T-cell suppressor factor (mRNA); Latency-associated peptide (mRNA); Polyergin (mRNA); TGF-beta-2 (mRNA); TGFB2 (mRNA); Transforming growth factor beta-2 (mRNA); TGFB2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Brain cancer [ICD9: 191, 225.0; ICD10: C71, D33] | ||||
| Non-small cell lung cancer; Small-cell lung cancer [ICD9:162.9; ICD10: C33-C34] | |||||
| Function |
TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.
|
||||
| BioChemical Class |
Target of antisense drug
|
||||
| UniProt ID | |||||
| Sequence |
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Cytokine-cytokine receptor interaction | |||||
| FoxO signaling pathway | |||||
| Cell cycle | |||||
| Endocytosis | |||||
| TGF-beta signaling pathway | |||||
| Osteoclast differentiation | |||||
| Hippo signaling pathway | |||||
| Leishmaniasis | |||||
| Chagas disease (American trypanosomiasis) | |||||
| Malaria | |||||
| Toxoplasmosis | |||||
| Amoebiasis | |||||
| Tuberculosis | |||||
| Hepatitis B | |||||
| HTLV-I infection | |||||
| Pathways in cancer | |||||
| Proteoglycans in cancer | |||||
| MicroRNAs in cancer | |||||
| Colorectal cancer | |||||
| Renal cell carcinoma | |||||
| Pancreatic cancer | |||||
| Chronic myeloid leukemia | |||||
| Inflammatory bowel disease (IBD) | |||||
| Rheumatoid arthritis | |||||
| Hypertrophic cardiomyopathy (HCM) | |||||
| Dilated cardiomyopathy | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| EGFR1 Signaling Pathway | |||||
| TGF_beta_Receptor Signaling Pathway | |||||
| TNFalpha Signaling Pathway | |||||
| PANTHER Pathway | TGF-beta signaling pathway | ||||
| Pathway Interaction Database | Glypican 1 network | ||||
| ATF-2 transcription factor network | |||||
| Signaling events mediated by the Hedgehog family | |||||
| Regulation of retinoblastoma protein | |||||
| TGF-beta receptor signaling | |||||
| Reactome | Platelet degranulation | ||||
| Molecules associated with elastic fibres | |||||
| ECM proteoglycans | |||||
| WikiPathways | Endochondral Ossification | ||||
| p38 MAPK Signaling Pathway | |||||
| MAPK Signaling Pathway | |||||
| NRF2 pathway | |||||
| Extracellular vesicle-mediated signaling in recipient cells | |||||
| Extracellular matrix organization | |||||
| Elastic fibre formation | |||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.