Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T50912
|
||||
| Former ID |
TTDS00490
|
||||
| Target Name |
T-lymphocyte activation antigen CD86
|
||||
| Gene Name |
CD86
|
||||
| Synonyms |
Activation B7-2 antigen; B70; BU63; CD28LG2; CTLA-4 counter-receptor B7.2; FUN-1; CD86
|
||||
| Target Type |
Successful
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86] | |||||
| Function |
Receptor involved in the costimulatory signal essential for t-lymphocyte proliferation and interleukin-2 production, by binding cd28 or ctla-4. May play a critical role in the early events of t-cell activation and costimulationof naive t-cells, such as deciding between immunity and anergy that is made by t-cells within 24 hours after activation. Isoform 2 interferes with the formation of cd86 clusters, and thus acts as a negative regulator of t-cell activation.
|
||||
| BioChemical Class |
Immunoglobulin
|
||||
| Target Validation |
T50912
|
||||
| UniProt ID | |||||
| Sequence |
MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK IHIPERSDEAQRVFKSSKTSSCDKSDTCF |
||||
| Structure |
1I85; 1NCN
|
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cell adhesion molecules (CAMs) | ||||
| Toll-like receptor signaling pathway | |||||
| Intestinal immune network for IgA production | |||||
| Type I diabetes mellitus | |||||
| Transcriptional misregulation in cancer | |||||
| Autoimmune thyroid disease | |||||
| Systemic lupus erythematosus | |||||
| Rheumatoid arthritis | |||||
| Allograft rejection | |||||
| Graft-versus-host disease | |||||
| Viral myocarditis | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| IL3 Signaling Pathway | |||||
| IL4 Signaling Pathway | |||||
| RANKL Signaling Pathway | |||||
| PANTHER Pathway | T cell activation | ||||
| Pathway Interaction Database | TCR signaling in na& | ||||
| #xef | |||||
| ve CD4+ T cells | |||||
| TCR signaling in na& | |||||
| ve CD8+ T cells | |||||
| IL12 signaling mediated by STAT4 | |||||
| Reactome | PIP3 activates AKT signaling | ||||
| Constitutive Signaling by Aberrant PI3K in Cancer | |||||
| CD28 co-stimulation | |||||
| CD28 dependent PI3K/Akt signaling | |||||
| CD28 dependent Vav1 pathway | |||||
| CTLA4 inhibitory signaling | |||||
| WikiPathways | Toll-like receptor signaling pathway | ||||
| Inflammatory Response Pathway | |||||
| IL-3 Signaling Pathway | |||||
| PIP3 activates AKT signaling | |||||
| Allograft Rejection | |||||
| Costimulation by the CD28 family | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| References | |||||
| Ref 524627 | ClinicalTrials.gov (NCT02052375) A Study To Evaluate the Pharmacokinetics, Pharmacodynamics, Safety and Tolerability of ASP2408 After Multiple Dose Subcutaneous Injections in Patients With RheumatoidArthritis on Methotrexate. U.S. National Institutes of Health. | ||||
| Ref 536737 | Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54. | ||||
| Ref 531427 | Trans-endocytosis of CD80 and CD86: a molecular basis for the cell-extrinsic function of CTLA-4. Science. 2011 Apr 29;332(6029):600-3. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.