Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T50942
|
||||
Former ID |
TTDC00189
|
||||
Target Name |
Tumor necrosis factor receptor superfamily member 16
|
||||
Gene Name |
NGFR
|
||||
Synonyms |
75kD-neurotrophin receptor; Gp80-LNGFR; Low-affinity nerve growth factor receptor; Lowaffinity neurotrophin receptor p75NTR; NGF-P75 receptor; NGFreceptor; P75ICD; P75NTR; P75neurotrophin receptor (p75(NTR)); NGFR
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Arthralgia; Back pain; Cancer pain [ICD9:724.5, 338, 780, 140-229; ICD10: M25.5, M54, G89, R52] | |||||
Cystitis [ICD10: N30] | |||||
Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63] | |||||
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
Motor neurone disease [ICD9: 335.2; ICD10: G12.2] | |||||
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Unspecified [ICD code not available] | |||||
Function |
Plays a role in the regulation of the translocation of GLUT4 to the cell surface in adipocytes and skeletal muscle cells in response to insulin, probably by regulating RAB31 activity, and thereby contributes to the regulation of insulin-dependent glucose uptake (By similarity). Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neuralcells. Necessary for the circadian oscillation of the clock genes ARNTL/BMAL1, PER1, PER2 and NR1D1 in the suprachiasmatic nucleus (SCN) of the brain and in liver and of the genes involved in glucoseand lipid metabolism in the liver.
|
||||
BioChemical Class |
Cytokine receptor
|
||||
Target Validation |
T50942
|
||||
UniProt ID | |||||
Sequence |
MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE STATSPV |
||||
Drugs and Mode of Action | |||||
Drug(s) | Fulranumab | Drug Info | Phase 3 | Arthralgia; Back pain; Cancer pain | [525054] |
SPI-205 | Drug Info | Phase 2 | Parkinson's disease | [521523] | |
Org-2766 | Drug Info | Discontinued in Phase 3 | Cognitive disorders | [544514] | |
BU-4514N | Drug Info | Terminated | Alzheimer disease | [545876] | |
CEP-427 | Drug Info | Terminated | Alzheimer disease | [546139] | |
ReN-1820 | Drug Info | Terminated | Cystitis | [547599] | |
Modulator | Axogenesis Factor-1 | Drug Info | [543520] | ||
BU-4514N | Drug Info | [533988] | |||
CEP-427 | Drug Info | [543520] | |||
LM11A-31 | Drug Info | ||||
Nerve growth factor conjugated RAP peptide | Drug Info | [543520] | |||
Org-2766 | Drug Info | [526759] | |||
SPI-205 | Drug Info | ||||
TDI-0059 | Drug Info | [543520] | |||
Antagonist | Fulranumab | Drug Info | [543520] | ||
TrkA-IgG | Drug Info | [535214] | |||
Inhibitor | ReN-1820 | Drug Info | [544104] | ||
Agonist | TDI-0033 | Drug Info | [543520] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Ras signaling pathway | ||||
Rap1 signaling pathway | |||||
Cytokine-cytokine receptor interaction | |||||
PI3K-Akt signaling pathway | |||||
Neurotrophin signaling pathway | |||||
Transcriptional misregulation in cancer | |||||
Pathway Interaction Database | p75(NTR)-mediated signaling | ||||
Neurotrophic factor-mediated Trk receptor signaling | |||||
Reactome | Axonal growth inhibition (RHOA activation) | ||||
NRAGE signals death through JNK | |||||
p75NTR negatively regulates cell cycle via SC1 | |||||
Regulated proteolysis of p75NTR | |||||
NADE modulates death signalling | |||||
NRIF signals cell death from the nucleus | |||||
p75NTR recruits signalling complexes | |||||
NF-kB is activated and signals survival | |||||
Axonal growth stimulation | |||||
WikiPathways | Spinal Cord Injury | ||||
BDNF signaling pathway | |||||
Signalling by NGF | |||||
References | |||||
Ref 521523 | ClinicalTrials.gov (NCT00041795) Neotrofin for Treatment of Chemotherapy-Induced Peripheral Neuropathy. U.S. National Institutes of Health. | ||||
Ref 525054 | ClinicalTrials.gov (NCT02336685) Study of Efficacy, Safety of Fulranumab Adjunctive Use in OA of Hip or Knee, PAI3001. U.S. National Institutes of Health. | ||||
Ref 544514 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000019) | ||||
Ref 545876 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005173) | ||||
Ref 526759 | Effects of the ACTH4-9 analog Org2766 on brain plasticity: modulation of excitatory neurotransmission. Psychoneuroendocrinology. 1992 Aug;17(4):315-25. | ||||
Ref 533988 | A new neuritogenetic compound BU-4514N produced by Microtetraspora sp. J Antibiot (Tokyo). 1993 Jun;46(6):875-83. | ||||
Ref 535214 | Nerve growth factor inhibition prevents traumatic neuroma formation in the rat. J Hand Surg Am. 2001 Jul;26(4):635-44. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.