Target Information

Target General Infomation
Target ID
T65197
Former ID
TTDS00144
Target Name
Erythropoietin Receptor
Gene Name
EPOR
Synonyms
EPO-R; Full-length form; EPOR
Target Type
Successful
Disease Anemia [ICD9: 280-285; ICD10: D50-D64]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Diabetic retinopathy [ICD9: 250.5; ICD10: H36, E10.3, E11.3, E13.3]
Emesis; Kidney transplant rejection [ICD9:787, 996.81; ICD10: R11, T86.1]
Hematological disease [ICD10: D50-D89]
Function
Isoform EPOR-T acts as a dominant-negative receptor of EPOR-mediated signaling.
BioChemical Class
Type I cytokine receptor
Target Validation
T65197
UniProt ID
P19235
Sequence
MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDL
VCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRY
EVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV
SLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVG
SEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGAS
AASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL
SDGPYSNPYENSLIPAAEPLPPSYVACS
Drugs and Mode of Action
Drug(s) Darbepoetin alfa Drug Info Approved Anemia [537115]
Epoetin alfa Drug Info Approved Anemia [538380]
Methoxy polyethylene glycol-epoetin beta Drug Info Approved Emesis; Kidney transplant rejection [529282], [551871]
RHuEPO Drug Info Approved Cancer [546426], [551871]
Epoetin zeta Drug Info Phase 3 Anemia [529265]
ErepoXen Drug Info Phase 3 Anemia [549217]
Hematide Drug Info Phase 3 Anemia [551985]
GlycoPEGylated erythropoietin Drug Info Discontinued in Phase 2 Cancer [547682]
Albupoietin Drug Info Terminated Anemia [547579]
Inhibitor 3,5 DIBROMOTYROSINE Drug Info [551374]
Modulator Albupoietin Drug Info [549799]
EPO peptide mimetics Drug Info [543465]
EPO-derived peptide Drug Info [543465]
Epoetin zeta Drug Info [529757]
GlycoPEGylated erythropoietin Drug Info [544013]
Nova-EPO Drug Info [543465]
PharmaPEG-EPO Drug Info [543465]
Stimulator BBT-009 Drug Info [543465]
BBT-021 Drug Info [543465]
Erythropoietin Drug Info [543465]
P-1116 Drug Info [543465]
PEG-EPO Drug Info [543465]
PT-401 Drug Info [543465]
RHuEPO Drug Info [543465]
Agonist Darbepoetin alfa Drug Info [534882]
Epoetin alfa Drug Info [535660], [537090]
ErepoXen Drug Info [528354]
Hematide Drug Info [531837], [532210], [537308]
Activator Methoxy polyethylene glycol-epoetin beta Drug Info [529282]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
NetPath Pathway TGF_beta_Receptor Signaling Pathway
Pathway Interaction Database Signaling events mediated by Stem cell factor receptor (c-Kit)
EPO signaling pathway
WikiPathways EPO Receptor Signaling
References
Ref 529265Comparison of the therapeutic effects of epoetin zeta to epoetin alfa in the maintenance phase of renal anaemia treatment. Curr Med Res Opin. 2008 Mar;24(3):625-37.
Ref 5292822007 FDA drug approvals: a year of flux. Nat Rev Drug Discov. 2008 Feb;7(2):107-9.
Ref 537115Emerging treatments for traumatic brain injury. Expert Opin Emerg Drugs. 2009 Mar;14(1):67-84.
Ref 538380FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (BLA) 103951.
Ref 546426Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008056)
Ref 547579Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017518)
Ref 547682Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018390)
Ref 549217Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033828)
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 551985Clinical pipeline report, company report or official report of Takeda.
Ref 528354Combination erythropoietin-hydroxyurea therapy in sickle cell disease: experience from the National Institutes of Health and a literature review. Haematologica. 2006 Aug;91(8):1076-83.
Ref 5292822007 FDA drug approvals: a year of flux. Nat Rev Drug Discov. 2008 Feb;7(2):107-9.
Ref 529757Long-term safety and tolerability of epoetin zeta, administered intravenously, for maintenance treatment of renal anemia. Adv Ther. 2008 Nov;25(11):1215-28.
Ref 531837Peginesatide and erythropoietin stimulate similar erythropoietin receptor-mediated signal transduction and gene induction events. Exp Hematol. 2012 Jul;40(7):575-87.
Ref 532210Nat Rev Drug Discov. 2013 Feb;12(2):87-90.
Ref 534882A cytosolic domain of the erythropoietin receptor contributes to endoplasmic reticulum-associated degradation. Eur J Biochem. 1999 Jul;263(2):410-9.
Ref 535660Knockouts model the 100 best-selling drugs--will they model the next 100? Nat Rev Drug Discov. 2003 Jan;2(1):38-51.
Ref 5370902007 Standards, Options, and Recommendations: use of erythropoiesis-stimulating agents (ESA: epoetin alfa, epoetin beta, and darbepoetin) for the management of anemia in children with cancer. PediatrBlood Cancer. 2009 Jul;53(1):7-12.
Ref 537308Anemia in chronic kidney disease: status of new therapies. Curr Opin Nephrol Hypertens. 2009 Mar;18(2):112-5.
Ref 543465(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1718).
Ref 544013Design of Homogeneous, MonoPEGylated Erythropoietin Analogs With Preserved In Vitro Bioactivity. Exp Hematol. 2006 June; 34(6): 697-704.
Ref 549799Clinical pipeline report, company report or official report of cogenesys.
Ref 551374The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.