Target Information

Target General Infomation
Target ID
T74002
Former ID
TTDR00322
Target Name
Granulocyte-macrophage colony-stimulating factor
Gene Name
CSF2
Synonyms
CSF; Colony-stimulating factor; GM-CSF; Molgramostin; Sargramostim; CSF2
Target Type
Successful
Disease Autoimmune diabetes [ICD10: E08-E13]
Bladder cancer [ICD9: 188; ICD10: C67]
Colorectal cancer; Liver cancer [ICD9:153, 154, 140-229, 155, 203.0; ICD10: C18-C21, C22]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Melanoma [ICD9: 172; ICD10: C43]
Ovarian cancer [ICD9: 183; ICD10: C56]
Plaque psoriasis [ICD10: L00-L99]
Prostate cancer [ICD9: 185; ICD10: C61]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Severe asthma [ICD9: 493; ICD10: J45]
Unspecified [ICD code not available]
Function
Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
BioChemical Class
Growth factor
UniProt ID
P04141
Sequence
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE
Drugs and Mode of Action
Drug(s) Talimogene Laherparepvec Drug Info Approved Melanoma [551871]
Talminogene laherparepvec Drug Info Phase 3 Melanoma [549695]
FANG vaccine Drug Info Phase 2/3 Ovarian cancer [531742]
JX-594 Drug Info Phase 2 Colorectal cancer; Liver cancer [524578]
KB-003 Drug Info Phase 2 Severe asthma [522819]
KB002/003 Drug Info Phase 2 Rheumatoid arthritis [551064]
MT203 Drug Info Phase 2 Plaque psoriasis [525125], [889396]
Autologous melanoma cell vaccine Drug Info Phase 1 Cancer [550600]
CDNA vaccine Drug Info Phase 1 Prostate cancer [549885]
CGTG-102 Drug Info Phase 1 Solid tumours [523632]
MORAb-022 Drug Info Phase 1 Autoimmune diabetes [523491]
CG-0070 Drug Info Discontinued in Phase 2/3 Bladder cancer [547793]
RPK-739 Drug Info Terminated Cancer [548281]
Modulator Autologous melanoma cell vaccine Drug Info [1572591]
CDNA vaccine Drug Info [1572591]
CGTG-102 Drug Info [532607]
FANG vaccine Drug Info [531742]
GM-CSF/B7-2 gene therapy and vaccine (CIT, cancer) Drug Info [1572605]
human monoclonal antibodies (GM-CSF) Drug Info [1572605]
JX-594 Drug Info [528365]
KB002/003 Drug Info [1572591]
MT203 Drug Info [533169]
RPK-739 Drug Info [556264]
Talimogene Laherparepvec Drug Info [556264]
Agonist CG-0070 Drug Info [550905]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Hematopoietic cell lineage
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Salmonella infection
Amoebiasis
HTLV-I infection
Transcriptional misregulation in cancer
Rheumatoid arthritis
NetPath Pathway IL1 Signaling Pathway
TCR Signaling Pathway
IL2 Signaling Pathway
TNFalpha Signaling Pathway
Pathway Interaction Database GMCSF-mediated signaling events
Calcineurin-regulated NFAT-dependent transcription in lymphocytes
Glucocorticoid receptor regulatory network
Alpha9 beta1 integrin signaling events
AP-1 transcription factor network
Calcium signaling in the CD4+ TCR pathway
Syndecan-2-mediated signaling events
Regulation of retinoblastoma protein
PathWhiz Pathway Fc Epsilon Receptor I Signaling in Mast Cells
Reactome GPVI-mediated activation cascade
gamma signalling through PI3Kgamma
Interleukin-3, 5 and GM-CSF signaling
RAF/MAP kinase cascade
Interleukin receptor SHC signaling
WikiPathways Cytokines and Inflammatory Response
Hematopoietic Stem Cell Differentiation
Interleukin-2 signaling
Interleukin-3, 5 and GM-CSF signaling
References
Ref 522819ClinicalTrials.gov (NCT00995449) Study of KB003 In Biologics-Inadequate Rheumatoid Arthritis. U.S. National Institutes of Health.
Ref 523491ClinicalTrials.gov (NCT01357759) Safety and Tolerability of MORAb-022 in Healthy and Rheumatoid Arthritis Subjects. U.S. National Institutes of Health.
Ref 523632ClinicalTrials.gov (NCT01437280) GOAT; Phase I Open Label Study of CGTG-102, a GM-CSF Encoding Oncolytic Adenovirus, for Advanced Cancers. U.S. National Institutes of Health.
Ref 524578ClinicalTrials.gov (NCT02017678) Phase 2 Study of JX-594 in Patients With Peritoneal Carcinomatosis of Ovarian Cancer Origin. U.S. National Institutes of Health.
Ref 525125ClinicalTrials.gov (NCT02393378) Namilumab vs Adalimumab in Participants With Moderate to Severe Early Rheumatoid Arthritis Inadequately Responding to Methotrexate. U.S. National Institutes of Health.
Ref 531742Phase I trial of "bi-shRNAi(furin)/GMCSF DNA/autologous tumor cell" vaccine (FANG) in advanced cancer. Mol Ther. 2012 Mar;20(3):679-86.
Ref 547793Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019332)
Ref 548281Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024125)
Ref 549695J Clin Oncol 32:5s, 2014 (suppl, abstr 9008a).
Ref 549885Clinical pipeline report, company report or official report of MannKind Corporation.
Ref 550600Clinical pipeline report, company report or official report of Dana-Farber Cancer Institute Inc.
Ref 551064Clinical pipeline report, company report or official report of KaloBios Pharmaceuticals.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 889396ClinicalTrials.gov (NCT02129777) Efficacy and Safety of Namilumab (MT203) for Plaque Psoriasis
Ref
Ref 528365Systemic armed oncolytic and immunologic therapy for cancer with JX-594, a targeted poxvirus expressing GM-CSF. Mol Ther. 2006 Sep;14(3):361-70.
Ref 531742Phase I trial of "bi-shRNAi(furin)/GMCSF DNA/autologous tumor cell" vaccine (FANG) in advanced cancer. Mol Ther. 2012 Mar;20(3):679-86.
Ref 532607Serotype chimeric oncolytic adenovirus coding for GM-CSF for treatment of sarcoma in rodents and humans. Int J Cancer. 2014 Aug 1;135(3):720-30.
Ref 533169GM-CSF as a target in inflammatory/autoimmune disease: current evidence and future therapeutic potential. Expert Rev Clin Immunol. 2015 Apr;11(4):457-65.
Ref 549685J Clin Oncol 31, 2013 (suppl; abstr LBA9008).
Ref 550905US patent application no. 2012,0082,687, Use of cell adhesion inhibitor for the mobilization of antigen presenting cells and immune cells in a cell mixture (aim) from the peripheral blood and methodsof use.
Ref 551162Clinical pipeline report, company report or official report of Morphotek.
Ref 551919US patent application no. 2010,0158,905, Combination therapy of arthritis with tranilast.
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
Ref 1572591Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
Ref 1572605The ChEMBL database in 2017.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.