Target Information

Target General Infomation
Target ID
T50942
Former ID
TTDC00189
Target Name
Tumor necrosis factor receptor superfamily member 16
Gene Name
NGFR
Synonyms
75kD-neurotrophin receptor; Gp80-LNGFR; Low-affinity nerve growth factor receptor; Lowaffinity neurotrophin receptor p75NTR; NGF-P75 receptor; NGFreceptor; P75ICD; P75NTR; P75neurotrophin receptor (p75(NTR)); NGFR
Target Type
Clinical Trial
Disease Alzheimer disease [ICD9: 331; ICD10: G30]
Arthralgia; Back pain; Cancer pain [ICD9:724.5, 338, 780, 140-229; ICD10: M25.5, M54, G89, R52]
Cystitis [ICD10: N30]
Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63]
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3]
Motor neurone disease [ICD9: 335.2; ICD10: G12.2]
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32]
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89]
Parkinson's disease [ICD9: 332; ICD10: G20]
Unspecified [ICD code not available]
Function
Plays a role in the regulation of the translocation of GLUT4 to the cell surface in adipocytes and skeletal muscle cells in response to insulin, probably by regulating RAB31 activity, and thereby contributes to the regulation of insulin-dependent glucose uptake (By similarity). Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neuralcells. Necessary for the circadian oscillation of the clock genes ARNTL/BMAL1, PER1, PER2 and NR1D1 in the suprachiasmatic nucleus (SCN) of the brain and in liver and of the genes involved in glucoseand lipid metabolism in the liver.
BioChemical Class
Cytokine receptor
Target Validation
T50942
UniProt ID
P08138
Sequence
MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
Drugs and Mode of Action
Drug(s) Fulranumab Drug Info Phase 3 Arthralgia; Back pain; Cancer pain [525054]
SPI-205 Drug Info Phase 2 Parkinson's disease [521523]
Org-2766 Drug Info Discontinued in Phase 3 Cognitive disorders [544514]
BU-4514N Drug Info Terminated Alzheimer disease [545876]
CEP-427 Drug Info Terminated Alzheimer disease [546139]
ReN-1820 Drug Info Terminated Cystitis [547599]
Modulator Axogenesis Factor-1 Drug Info [543520]
BU-4514N Drug Info [533988]
CEP-427 Drug Info [543520]
LM11A-31 Drug Info
Nerve growth factor conjugated RAP peptide Drug Info [543520]
Org-2766 Drug Info [526759]
SPI-205 Drug Info
TDI-0059 Drug Info [543520]
Antagonist Fulranumab Drug Info [543520]
TrkA-IgG Drug Info [535214]
Inhibitor ReN-1820 Drug Info [544104]
Agonist TDI-0033 Drug Info [543520]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Neurotrophin signaling pathway
Transcriptional misregulation in cancer
Pathway Interaction Database p75(NTR)-mediated signaling
Neurotrophic factor-mediated Trk receptor signaling
Reactome Axonal growth inhibition (RHOA activation)
NRAGE signals death through JNK
p75NTR negatively regulates cell cycle via SC1
Regulated proteolysis of p75NTR
NADE modulates death signalling
NRIF signals cell death from the nucleus
p75NTR recruits signalling complexes
NF-kB is activated and signals survival
Axonal growth stimulation
WikiPathways Spinal Cord Injury
BDNF signaling pathway
Signalling by NGF
References
Ref 521523ClinicalTrials.gov (NCT00041795) Neotrofin for Treatment of Chemotherapy-Induced Peripheral Neuropathy. U.S. National Institutes of Health.
Ref 525054ClinicalTrials.gov (NCT02336685) Study of Efficacy, Safety of Fulranumab Adjunctive Use in OA of Hip or Knee, PAI3001. U.S. National Institutes of Health.
Ref 544514Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000019)
Ref 545876Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005173)
Ref 546139Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006555)
Ref 547599Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017720)
Ref 526759Effects of the ACTH4-9 analog Org2766 on brain plasticity: modulation of excitatory neurotransmission. Psychoneuroendocrinology. 1992 Aug;17(4):315-25.
Ref 533988A new neuritogenetic compound BU-4514N produced by Microtetraspora sp. J Antibiot (Tokyo). 1993 Jun;46(6):875-83.
Ref 535214Nerve growth factor inhibition prevents traumatic neuroma formation in the rat. J Hand Surg Am. 2001 Jul;26(4):635-44.
Ref 543520(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1888).
Ref 544104Phosphorylation of Extracellular Signal-Regulated Kinases (pERK1/2) in Bladder Afferent Pathways with Cyclophosphamide (CYP)-Induced Cystitis. Neuroscience. 2009 November 10; 163(4): 1353-1362.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.