Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T81850
|
||||
Former ID |
TTDC00106
|
||||
Target Name |
Squalene synthetase
|
||||
Gene Name |
FDFT1
|
||||
Synonyms |
FPP:FPP farnesyltransferase; SQS; SS; Squalene synthase; Squalene synthetase; FDFT1
|
||||
Target Type |
Discontinued
|
||||
Disease | Arteriosclerosis [ICD9: 440; ICD10: I70] | ||||
Hyperlipidaemia [ICD9: 272.0-272.4; ICD10: E78] | |||||
Hypercholesterolemia [ICD10: E78] | |||||
BioChemical Class |
Alkyl aryl transferase
|
||||
Target Validation |
T81850
|
||||
UniProt ID | |||||
EC Number |
EC 2.5.1.21
|
||||
Sequence |
MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQA
LDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQ VLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVG IGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYV KKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATL AACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTR QIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDYVQTGEH |
||||
Drugs and Mode of Action | |||||
Drug(s) | Lapaquistat acetate | Drug Info | Discontinued in Phase 3 | Hyperlipidaemia | [522119] |
BMS-187745 | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [531655] | |
SQ-32709 | Drug Info | Discontinued in Phase 2 | Arteriosclerosis | [545908] | |
A-87049 | Drug Info | Terminated | Discovery agent | [546182] | |
RPR-101821 | Drug Info | Terminated | Arteriosclerosis | [546131] | |
SQ-34919 | Drug Info | Terminated | Discovery agent | [540105], [545851] | |
Squalestatin 1 | Drug Info | Terminated | Arteriosclerosis | [540059], [545281] | |
Inhibitor | (Z)-3-[2-(9H-fluoren-2-yloxy)ethylidene]-quinuclidine hydrochloride 31 | Drug Info | [535732] | ||
1-allyl-2-[3-(isopropylamino)propoxy]-9H-carbazole | Drug Info | [527258] | |||
1-allyl-2-[3-(isopropylamino)propoxy]-9H-xanthen-9-one | Drug Info | [527258] | |||
2-[4-(2-Thienyl)phenyl]-4-methylmorpholin-2-ol | Drug Info | [529661] | |||
3-[1'-{4'-(Benzyloxy)-phenyl}]-quinuclidine-2-ene | Drug Info | [528993] | |||
3-[7'-(Methoxy)-napht-2'-yl]-quinuclidine-2-ene | Drug Info | [528993] | |||
A-87049 | Drug Info | [534419] | |||
BMS-187745 | Drug Info | [529947] | |||
BPH-652 | Drug Info | [543910] | |||
BPH-830 | Drug Info | [530152] | |||
compound 1 | Drug Info | [534061] | |||
compound 1 (Overhand et al., 1997) | Drug Info | [543910] | |||
compound 10 | Drug Info | [529661] | |||
compound 11 | Drug Info | [533586] | |||
compound 12 | Drug Info | [530797] | |||
compound 12 (Wattanasin et al.,1997) | Drug Info | [543910] | |||
compound 13 | Drug Info | [530152] | |||
compound 14 | Drug Info | [529947] | |||
compound 14 | Drug Info | [534782] | |||
compound 15 | Drug Info | [530152] | |||
compound 15 | Drug Info | [534158] | |||
compound 15 (Biller et al., 1993) | Drug Info | [543910] | |||
compound 15a | Drug Info | [531861] | |||
compound 16a (Sharratt et al., 1994) | Drug Info | [543910] | |||
compound 17 | Drug Info | [529661] | |||
compound 17 | Drug Info | [534158] | |||
compound 17 (Shechter et al., 1996) | Drug Info | [543910] | |||
compound 18 | Drug Info | [529661] | |||
compound 19 | Drug Info | [533586] | |||
compound 19 | Drug Info | [529661] | |||
compound 19 | Drug Info | [529947] | |||
compound 1c (Brown et al., 1997) | Drug Info | [543910] | |||
compound 1e (Brown et al., 1997) | Drug Info | [543910] | |||
compound 20 | Drug Info | [530797] | |||
compound 20 | Drug Info | [533586] | |||
compound 20 (Shechter et al., 1996) | Drug Info | [543910] | |||
compound 21 | Drug Info | [529947] | |||
compound 21 | Drug Info | [533586] | |||
compound 23 | Drug Info | [534158] | |||
compound 28 | Drug Info | [533586] | |||
compound 2a (+) | Drug Info | [534158] | |||
compound 2d | Drug Info | [533667] | |||
compound 2e | Drug Info | [533667] | |||
compound 3 | Drug Info | [529947] | |||
compound 32 | Drug Info | [529947] | |||
compound 35 | Drug Info | [529947] | |||
compound 3a | Drug Info | [526429] | |||
compound 3f | Drug Info | [526429] | |||
compound 3f | Drug Info | [533824] | |||
compound 4 | Drug Info | [529661] | |||
compound 4 | Drug Info | [534096] | |||
compound 4 | Drug Info | [534158] | |||
compound 4 (Brinkman et al., 1996) | Drug Info | [543910] | |||
compound 4e | Drug Info | [533824] | |||
compound 4g | Drug Info | [528993] | |||
compound 4q | Drug Info | [533676] | |||
compound 5 | Drug Info | [529661] | |||
compound 5d | Drug Info | [533824] | |||
compound 5j | Drug Info | [534419] | |||
compound 5m | Drug Info | [534419] | |||
compound 6 | Drug Info | [529947] | |||
compound 6 (Biller et al., 1991) | Drug Info | [543910] | |||
compound 6c | Drug Info | [533824] | |||
compound 6d | Drug Info | [533824] | |||
compound 6g | Drug Info | [533824] | |||
compound 7 | Drug Info | [529661] | |||
compound 7 | Drug Info | [534058] | |||
compound 7 (Brinkman et al., 1996) | Drug Info | [543910] | |||
compound 8 | Drug Info | [529661] | |||
compound 8 | Drug Info | [529947] | |||
compound 8 (Brinkman et al., 1996) | Drug Info | [543910] | |||
compound 9 | Drug Info | [529661] | |||
CP-294838 | Drug Info | [534560] | |||
E5700 | Drug Info | [528739] | |||
ER-119884 | Drug Info | [528739] | |||
J-104118 | Drug Info | [543910] | |||
J-104123 | Drug Info | [543910] | |||
L-731120 | Drug Info | [543910] | |||
L-731128 | Drug Info | [543910] | |||
L-735021 | Drug Info | [533824] | |||
Lapaquistat acetate | Drug Info | [536444], [536754] | |||
N-hydroxyglycine derivative | Drug Info | [551333] | |||
SQ-34919 | Drug Info | [551299] | |||
YM-75440 | Drug Info | [527258] | |||
ZARAGOZIC ACID B | Drug Info | [551358] | |||
Zaragozic Acid C | Drug Info | [551358] | |||
Zaragozic Acid D | Drug Info | [551358] | |||
Zaragozic Acid D2 | Drug Info | [551358] | |||
ZARAGOZIC ACIDS A | Drug Info | [551358] | |||
Zwitterionic sulfobetaine derivative | Drug Info | [551306] | |||
Modulator | RPR-101821 | Drug Info | [534162] | ||
SQ-32709 | Drug Info | [526027] | |||
Squalestatin 1 | Drug Info | [527638] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Cholesterol biosynthesis II (via 24,25-dihydrolanosterol) | ||||
Cholesterol biosynthesis III (via desmosterol) | |||||
Cholesterol biosynthesis I | |||||
Superpathway of cholesterol biosynthesis | |||||
Epoxysqualene biosynthesis | |||||
KEGG Pathway | Steroid biosynthesis | ||||
Metabolic pathways | |||||
Biosynthesis of antibiotics | |||||
PANTHER Pathway | Cholesterol biosynthesis | ||||
PathWhiz Pathway | Steroid Biosynthesis | ||||
Reactome | Cholesterol biosynthesis | ||||
PPARA activates gene expression | |||||
Activation of gene expression by SREBF (SREBP) | |||||
WikiPathways | Statin Pathway | ||||
Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) | |||||
Activation of Gene Expression by SREBP (SREBF) | |||||
SREBP signalling | |||||
Cholesterol Biosynthesis | |||||
Cholesterol biosynthesis | |||||
References | |||||
Ref 522119 | ClinicalTrials.gov (NCT00532558) Efficacy of Lapaquistat Acetate on Blood Cholesterol Levels in Treating Subjects With Hypercholesterolemia. U.S. National Institutes of Health. | ||||
Ref 531655 | Potential role of nonstatin cholesterol lowering agents. IUBMB Life. 2011 Nov;63(11):964-71. | ||||
Ref 540059 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3057). | ||||
Ref 540105 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3101). | ||||
Ref 545281 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002681) | ||||
Ref 545851 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005042) | ||||
Ref 545908 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005302) | ||||
Ref 526027 | Clinical pharmacokinetics and pharmacodynamics of a new squalene synthase inhibitor, BMS-188494, in healthy volunteers. J Clin Pharmacol. 1998 Dec;38(12):1116-21. | ||||
Ref 526429 | Synthesis of novel 4,1-benzoxazepine derivatives as squalene synthase inhibitors and their inhibition of cholesterol synthesis. J Med Chem. 2002 Sep 26;45(20):4571-80. | ||||
Ref 527258 | Synthesis and biological evaluation of novel propylamine derivatives as orally active squalene synthase inhibitors. Bioorg Med Chem. 2004 Nov 15;12(22):5899-908. | ||||
Ref 527638 | Squalestatin 1, a potent inhibitor of squalene synthase, which lowers serum cholesterol in vivo. J Biol Chem. 1992 Jun 15;267(17):11705-8. | ||||
Ref 528739 | Antimicrob Agents Chemother. 2007 Jun;51(6):2123-9. Epub 2007 Mar 19.Kinetic characterization of squalene synthase from Trypanosoma cruzi: selective inhibition by quinuclidine derivatives. | ||||
Ref 528993 | Antimicrob Agents Chemother. 2007 Nov;51(11):4049-61. Epub 2007 Aug 20.Quinuclidine derivatives as potential antiparasitics. | ||||
Ref 529661 | J Med Chem. 2008 Sep 25;51(18):5861-5.Lipid-lowering (hetero)aromatic tetrahydro-1,4-oxazine derivatives with antioxidant and squalene synthase inhibitory activity. | ||||
Ref 529947 | J Med Chem. 2009 Feb 26;52(4):976-88.Phosphonosulfonates are potent, selective inhibitors of dehydrosqualene synthase and staphyloxanthin biosynthesis in Staphylococcus aureus. | ||||
Ref 530152 | Inhibition of staphyloxanthin virulence factor biosynthesis in Staphylococcus aureus: in vitro, in vivo, and crystallographic results. J Med Chem. 2009 Jul 9;52(13):3869-80. | ||||
Ref 530797 | Synthesis and preliminary pharmacological characterisation of a new class of nitrogen-containing bisphosphonates (N-BPs). Bioorg Med Chem. 2010 Apr 1;18(7):2428-38. | ||||
Ref 531861 | Discovery of novel tricyclic compounds as squalene synthase inhibitors. Bioorg Med Chem. 2012 May 1;20(9):3072-93. | ||||
Ref 533586 | Phenoxypropylamines: a new series of squalene synthase inhibitors. J Med Chem. 1995 Oct 13;38(21):4157-60. | ||||
Ref 533667 | 1,1-Bisphosphonate squalene synthase inhibitors: interplay between the isoprenoid subunit and the diphosphate surrogate. J Med Chem. 1995 Jul 7;38(14):2596-605. | ||||
Ref 533676 | (Aryloxy)methylsilane derivatives as new cholesterol biosynthesis inhibitors: synthesis and hypocholesterolemic activity of a new class of squalene epoxidase inhibitors. J Med Chem. 1995 Aug 18;38(17):3207-16. | ||||
Ref 533824 | Structure-activity relationships of C1 and C6 side chains of zaragozic acid A derivatives. J Med Chem. 1994 Nov 11;37(23):4031-51. | ||||
Ref 534058 | N-(arylalkyl)farnesylamines: new potent squalene synthetase inhibitors. J Med Chem. 1993 May 14;36(10):1501-4. | ||||
Ref 534061 | Amidinium cation as a mimic of allylic carbocation: synthesis and squalene synthetase inhibitory activity of an amidinium analog of a carbocation intermediate. J Med Chem. 1993 Mar 5;36(5):631-2. | ||||
Ref 534096 | Alpha-Phosphonosulfonic acids: potent and selective inhibitors of squalene synthase. J Med Chem. 1996 Feb 2;39(3):657-60. | ||||
Ref 534158 | Synthesis and activity of a novel series of 3-biarylquinuclidine squalene synthase inhibitors. J Med Chem. 1996 Jul 19;39(15):2971-9. | ||||
Ref 534162 | RPR 101821, a new potent cholesterol-lowering agent: inhibition of squalene synthase and 7-dehydrocholesterol reductase. Naunyn Schmiedebergs Arch Pharmacol. 1996 Jan;353(2):233-40. | ||||
Ref 534419 | J Med Chem. 1997 Jul 4;40(14):2123-5.(1 alpha, 2 beta, 3 beta, 4 alpha)-1,2-bis[N-propyl-N-(4-phenoxybenzyl) amino]carbonyl]cyclobutane-3,4-dicarboxylic acid (A-87049): a novel potent squalene synthase inhibitor. | ||||
Ref 534560 | Truncation of human squalene synthase yields active, crystallizable protein. Arch Biochem Biophys. 1998 Feb 15;350(2):283-90. | ||||
Ref 534782 | Cyclopentanedi- and tricarboxylic acids as squalene synthase inhibitors: syntheses and evaluation. Bioorg Med Chem Lett. 1998 Apr 21;8(8):891-6. | ||||
Ref 535732 | Syntheses and biological evaluation of novel quinuclidine derivatives as squalene synthase inhibitors. Bioorg Med Chem. 2003 May 29;11(11):2403-14. | ||||
Ref 536444 | Protective effects of a squalene synthase inhibitor, lapaquistat acetate (TAK-475), on statin-induced myotoxicity in guinea pigs. Toxicol Appl Pharmacol. 2007 Aug 15;223(1):39-45. Epub 2007 May 24. | ||||
Ref 536754 | Lapaquistat acetate, a squalene synthase inhibitor, changes macrophage/lipid-rich coronary plaques of hypercholesterolaemic rabbits into fibrous lesions. Br J Pharmacol. 2008 Jul;154(5):949-57. Epub2008 Apr 21. | ||||
Ref 543910 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 645). | ||||
Ref 551299 | Inhibition of farnesyl protein transferase by new farnesyl phosphonate derivatives of phenylalanine, Bioorg. Med. Chem. Lett. 6(12):1291-1296 (1996). | ||||
Ref 551306 | Sulfobetaine zwitterionic inhibitors of squalene synthase, Bioorg. Med. Chem. Lett. 6(21):2585-2588 (1996). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.