Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T10877
(Former ID: TTDNC00424)
|
|||||
| Target Name |
Cyclic ADP-ribose hydrolase 1 (CD38)
|
|||||
| Synonyms |
cADPr hydrolase 1; T10; Cyclic ADPribose hydrolase 1; ADPribosyl cyclase 1; ADPRC 1; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1; ADP-ribosyl cyclase 1; 2'-phospho-cyclic-ADP-ribose transferase; 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase; 2'-phospho-ADP-ribosyl cyclase
|
|||||
| Gene Name |
CD38
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Multiple myeloma [ICD-11: 2A83] | |||||
| Function |
Has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system. Synthesizes the second messagers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger for glucose-induced insulin secretion.
Click to Show/Hide
|
|||||
| BioChemical Class |
Glycosylase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 3.2.2.6
|
|||||
| Sequence |
MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQWSGPGTTKRFP
ETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDC SNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| HIT2.0 ID | T86MX7 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Daratumumab | Drug Info | Approved | Multiple myeloma | [2], [3], [4] | |
| Clinical Trial Drug(s) | [+] 19 Clinical Trial Drugs | + | ||||
| 1 | 4SCAR19 and 4SCAR38 | Drug Info | Phase 1/2 | B-cell lymphoma | [5] | |
| 2 | Anti-CD38 CAR-T cells | Drug Info | Phase 1/2 | Multiple myeloma | [6] | |
| 3 | CD38 and BCMA CAR-T Cells | Drug Info | Phase 1/2 | Multiple myeloma | [7] | |
| 4 | CD38 CAR T cells | Drug Info | Phase 1/2 | Multiple myeloma | [8] | |
| 5 | CD38 CAR-T Cell | Drug Info | Phase 1/2 | Acute lymphoblastic leukaemia | [9] | |
| 6 | CD38-specific gene-engineered T cells | Drug Info | Phase 1/2 | Acute myeloid leukaemia | [10] | |
| 7 | ISB 1342 | Drug Info | Phase 1/2 | Multiple myeloma | [11] | |
| 8 | MOR-202 | Drug Info | Phase 1/2 | Multiple myeloma | [12] | |
| 9 | SAR-650984 | Drug Info | Phase 1/2 | Haematological malignancy | [13] | |
| 10 | 225Ac-labelled aCD38 | Drug Info | Phase 1 | Multiple myeloma | [14] | |
| 11 | AMG 424 | Drug Info | Phase 1 | Multiple myeloma | [15] | |
| 12 | Anti-CD38 CAR-T cells | Drug Info | Phase 1 | Multiple myeloma | [16] | |
| 13 | CART-38 cells | Drug Info | Phase 1 | Myelodysplastic syndrome | [17] | |
| 14 | CD38 CAR-T | Drug Info | Phase 1 | Multiple myeloma | [18] | |
| 15 | SAR442085 | Drug Info | Phase 1 | Plasma cell myeloma | [19] | |
| 16 | SAR442257 | Drug Info | Phase 1 | Malignant neoplasm | [20] | |
| 17 | TAK-169 | Drug Info | Phase 1 | Multiple myeloma | [21] | |
| 18 | TAK-573 | Drug Info | Phase 1 | Refractory multiple myeloma | [22] | |
| 19 | CAR-T cells targeting CD38 | Drug Info | Clinical trial | Multiple myeloma | [23] | |
| Mode of Action | [+] 4 Modes of Action | + | ||||
| CAR-T-Cell-Therapy(Dual specific) | [+] 2 CAR-T-Cell-Therapy(Dual specific) drugs | + | ||||
| 1 | 4SCAR19 and 4SCAR38 | Drug Info | [5] | |||
| 2 | CD38 and BCMA CAR-T Cells | Drug Info | [7] | |||
| CAR-T-Cell-Therapy | [+] 7 CAR-T-Cell-Therapy drugs | + | ||||
| 1 | Anti-CD38 CAR-T cells | Drug Info | [6] | |||
| 2 | CD38 CAR T cells | Drug Info | [8] | |||
| 3 | CD38 CAR-T Cell | Drug Info | [9] | |||
| 4 | CD38-specific gene-engineered T cells | Drug Info | [10] | |||
| 5 | Anti-CD38 CAR-T cells | Drug Info | [16] | |||
| 6 | CART-38 cells | Drug Info | [17] | |||
| 7 | CAR-T cells targeting CD38 | Drug Info | [23], [32] | |||
| Inhibitor | [+] 5 Inhibitor drugs | + | ||||
| 1 | ISB 1342 | Drug Info | [24] | |||
| 2 | AMG 424 | Drug Info | [28] | |||
| 3 | SAR442085 | Drug Info | [29] | |||
| 4 | SAR442257 | Drug Info | [29] | |||
| 5 | TAK-169 | Drug Info | [30] | |||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | HuMax-CD38b | Drug Info | [33] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 8 KEGG Pathways | + | ||||
| 1 | Nicotinate and nicotinamide metabolism | |||||
| 2 | Metabolic pathways | |||||
| 3 | Calcium signaling pathway | |||||
| 4 | Hematopoietic cell lineage | |||||
| 5 | Oxytocin signaling pathway | |||||
| 6 | Salivary secretion | |||||
| 7 | Pancreatic secretion | |||||
| 8 | Epstein-Barr virus infection | |||||
| NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
| 1 | Leptin Signaling Pathway | |||||
| 2 | TCR Signaling Pathway | |||||
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | CCKR signaling map ST | |||||
| WikiPathways | [+] 1 WikiPathways | + | ||||
| 1 | Oxytocin signaling | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Targeting CD38 with Daratumumab Monotherapy in Multiple Myeloma. N Engl J Med. 2015 Sep 24;373(13):1207-19. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7395). | |||||
| REF 3 | ClinicalTrials.gov (NCT02252172) Study Comparing Daratumumab, Lenalidomide, and Dexamethasone With Lenalidomide and Dexamethasone in Participants With Previously Untreated Multiple Myeloma. U.S. National Institutes of Health. | |||||
| REF 4 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 5 | ClinicalTrials.gov (NCT03125577) Combination CAR-T Cell Therapy Targeting Hematological Malignancies | |||||
| REF 6 | ClinicalTrials.gov (NCT03638206) Autologous CAR-T/TCR-T Cell Immunotherapy for Malignancies | |||||
| REF 7 | ClinicalTrials.gov (NCT03767751) A Feasibility and Safety Study of Dual Specificity CD38 and BCMA CAR-T Cell Immunotherapy for Relapsed or Refractory Multiple Myeloma | |||||
| REF 8 | ClinicalTrials.gov (NCT03271632) Multi-CAR T Cell Therapy in the Treatment of Multiple Myeloma | |||||
| REF 9 | ClinicalTrials.gov (NCT03754764) A Feasibility and Safety Study of CD38 CAR-T Cell Immunotherapy for Relapsed B-cell Acute Lymphoblastic Leukemia After CD19 CAR-T Adoptive Cellular Immunotherapy | |||||
| REF 10 | ClinicalTrials.gov (NCT03222674) Multi-CAR T Cell Therapy for Acute Myeloid Leukemia | |||||
| REF 11 | ClinicalTrials.gov (NCT03309111) Study of ISB 1342, a CD38/CD3 Bispecific Antibody, in Subjects With Previously Treated Multiple Myeloma. U.S. National Institutes of Health. | |||||
| REF 12 | ClinicalTrials.gov (NCT01421186) A Phase I/IIa Study of Human Anti-CD38 Antibody MOR03087 (MOR202) in Relapsed/Refractory Multiple Myeloma. U.S. National Institutes of Health. | |||||
| REF 13 | ClinicalTrials.gov (NCT01084252) Phase 1/2 Dose Escalation and Efficacy Study of Anti-CD38 Monoclonal Antibody in Patients With Selected CD38+ Hematological Malignancies. U.S. National Institutes of Health. | |||||
| REF 14 | ClinicalTrials.gov (NCT02998047) A Phase I Study of Lintuzumab-Ac225 in Patients With Refractory Multiple Myeloma. U.S. National Institutes of Health. | |||||
| REF 15 | ClinicalTrials.gov (NCT03445663) Study Evaluating AMG 424 in Subjects With Multiple Myeloma. U.S. National Institutes of Health. | |||||
| REF 16 | ClinicalTrials.gov (NCT03464916) Study to Evaluate the Safety and Efficacy of Anti-CD38 CAR-T in Relapsed or Refractory Multiple Myeloma Patients | |||||
| REF 17 | ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS | |||||
| REF 18 | Clinical pipeline report, company report or official report of Sorrento Therapeutics. | |||||
| REF 19 | ClinicalTrials.gov (NCT04000282) First-in-human Single Agent Study of SAR442085 in Relapsed or Refractory Multiple Myeloma. U.S. National Institutes of Health. | |||||
| REF 20 | ClinicalTrials.gov (NCT04401020) First-in-human Single Agent Study of SAR442257 in RRMM and RR-NHL. U.S. National Institutes of Health. | |||||
| REF 21 | ClinicalTrials.gov (NCT04017130) A Study of TAK-169 in Participants With Relapsed or Refractory Multiple Myeloma. U.S. National Institutes of Health. | |||||
| REF 22 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 23 | ClinicalTrials.gov (NCT03473496) CAR-T Cells Therapy in Relapsed/Refractory Multiple Myeloma | |||||
| REF 24 | Clinical pipeline report, company report or official report of Ichnos Sciences. | |||||
| REF 25 | Clinical pipeline report, company report or official report of MorphoSys. | |||||
| REF 26 | Clinical pipeline report, company report or official report of Sanofi-Aventis. | |||||
| REF 27 | Radiopharmaceutical therapy in cancer: clinical advances and challenges. Nat Rev Drug Discov. 2020 Sep;19(9):589-608. | |||||
| REF 28 | Clinical pipeline report, company report or official report of Amgen. | |||||
| REF 29 | Clinical pipeline report, company report or official report of Sanofi. | |||||
| REF 30 | Clinical pipeline report, company report or official report of Molecular Templates. | |||||
| REF 31 | Clinical pipeline report, company report or official report of Takeda. | |||||
| REF 32 | ClinicalTrials.gov (NCT03473457) CAR-T Cells Therapy in Relapsed/Refractory Acute Myeloid Leukemia | |||||
| REF 33 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2766). | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.