Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T22274
(Former ID: TTDNC00542)
|
|||||
Target Name |
Histone deacetylase 6 (HDAC6)
|
|||||
Synonyms |
KIAA0901; JM21; HD6
|
|||||
Gene Name |
HDAC6
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Multiple myeloma [ICD-11: 2A83] | |||||
2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
Gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4).
Click to Show/Hide
|
|||||
BioChemical Class |
Carbon-nitrogen hydrolase
|
|||||
UniProt ID | ||||||
EC Number |
EC 3.5.1.98
|
|||||
Sequence |
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN IAHQNKFGEDMPHPH Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T77PFO |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | Citarinostat | Drug Info | Phase 1 | Multiple myeloma | [2] | |
2 | KA2507 | Drug Info | Phase 1 | Solid tumour/cancer | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 171 Inhibitor drugs | + | ||||
1 | Citarinostat | Drug Info | [2] | |||
2 | KA2507 | Drug Info | [2] | |||
3 | Diaryl amine derivative 2 | Drug Info | [3] | |||
4 | Diaryl amine derivative 3 | Drug Info | [3] | |||
5 | Diaryl amine derivative 4 | Drug Info | [3] | |||
6 | PMID28092474-Compound-32a | Drug Info | [3] | |||
7 | PMID28092474-Compound-32b | Drug Info | [3] | |||
8 | PMID28092474-Compound-32c | Drug Info | [3] | |||
9 | PMID28092474-Compound-32d | Drug Info | [3] | |||
10 | PMID28092474-Compound-32e | Drug Info | [3] | |||
11 | PMID28092474-Compound-32f | Drug Info | [3] | |||
12 | PMID28092474-Compound-32g | Drug Info | [3] | |||
13 | PMID28092474-Compound-32h | Drug Info | [3] | |||
14 | PMID28092474-Compound-32i | Drug Info | [3] | |||
15 | PMID28092474-Compound-32j | Drug Info | [3] | |||
16 | PMID28092474-Compound-32k | Drug Info | [3] | |||
17 | PMID28092474-Compound-32l | Drug Info | [3] | |||
18 | PMID28092474-Compound-32m | Drug Info | [3] | |||
19 | PMID28092474-Compound-32n | Drug Info | [3] | |||
20 | PMID28092474-Compound-32o | Drug Info | [3] | |||
21 | PMID28092474-Compound-32p | Drug Info | [3] | |||
22 | PMID28092474-Compound-32q | Drug Info | [3] | |||
23 | PMID28092474-Compound-32r | Drug Info | [3] | |||
24 | PMID28092474-Compound-32s | Drug Info | [3] | |||
25 | PMID28092474-Compound-32t | Drug Info | [3] | |||
26 | PMID28092474-Compound-32u | Drug Info | [3] | |||
27 | PMID28092474-Compound-32v | Drug Info | [3] | |||
28 | PMID28092474-Compound-32x | Drug Info | [3] | |||
29 | PMID28092474-Compound-32y | Drug Info | [3] | |||
30 | PMID28092474-Compound-32z | Drug Info | [3] | |||
31 | PMID28092474-Compound-33a | Drug Info | [3] | |||
32 | PMID28092474-Compound-33b | Drug Info | [3] | |||
33 | PMID28092474-Compound-33c | Drug Info | [3] | |||
34 | PMID28092474-Compound-33d | Drug Info | [3] | |||
35 | PMID28092474-Compound-33e | Drug Info | [3] | |||
36 | PMID28092474-Compound-33f | Drug Info | [3] | |||
37 | PMID28092474-Compound-33g | Drug Info | [3] | |||
38 | PMID28092474-Compound-33h | Drug Info | [3] | |||
39 | PMID28092474-Compound-33i | Drug Info | [3] | |||
40 | PMID28092474-Compound-33j | Drug Info | [3] | |||
41 | PMID28092474-Compound-33k | Drug Info | [3] | |||
42 | PMID28092474-Compound-33l | Drug Info | [3] | |||
43 | PMID28092474-Compound-33m | Drug Info | [3] | |||
44 | PMID28092474-Compound-33o | Drug Info | [3] | |||
45 | PMID28092474-Compound-33p | Drug Info | [3] | |||
46 | PMID28092474-Compound-34a | Drug Info | [3] | |||
47 | PMID28092474-Compound-34b | Drug Info | [3] | |||
48 | PMID28092474-Compound-34c | Drug Info | [3] | |||
49 | PMID29671355-Compound-11 | Drug Info | [4] | |||
50 | PMID29671355-Compound-13 | Drug Info | [4] | |||
51 | PMID29671355-Compound-14 | Drug Info | [4] | |||
52 | PMID29671355-Compound-15 | Drug Info | [4] | |||
53 | PMID29671355-Compound-16 | Drug Info | [4] | |||
54 | PMID29671355-Compound-18 | Drug Info | [4] | |||
55 | PMID29671355-Compound-19 | Drug Info | [4] | |||
56 | PMID29671355-Compound-21 | Drug Info | [4] | |||
57 | PMID29671355-Compound-22 | Drug Info | [4] | |||
58 | PMID29671355-Compound-23 | Drug Info | [4] | |||
59 | PMID29671355-Compound-24 | Drug Info | [4] | |||
60 | PMID29671355-Compound-25 | Drug Info | [4] | |||
61 | PMID29671355-Compound-26 | Drug Info | [4] | |||
62 | PMID29671355-Compound-27 | Drug Info | [4] | |||
63 | PMID29671355-Compound-28 | Drug Info | [4] | |||
64 | PMID29671355-Compound-31 | Drug Info | [4] | |||
65 | PMID29671355-Compound-38a | Drug Info | [4] | |||
66 | PMID29671355-Compound-38b | Drug Info | [4] | |||
67 | PMID29671355-Compound-39 | Drug Info | [4] | |||
68 | PMID29671355-Compound-43 | Drug Info | [4] | |||
69 | PMID29671355-Compound-44 | Drug Info | [4] | |||
70 | PMID29671355-Compound-56 | Drug Info | [4] | |||
71 | PMID29671355-Compound-61 | Drug Info | [4] | |||
72 | PMID29671355-Compound-62 | Drug Info | [4] | |||
73 | PMID29671355-Compound-65a | Drug Info | [4] | |||
74 | PMID29671355-Compound-67 | Drug Info | [4] | |||
75 | PMID29671355-Compound-73 | Drug Info | [4] | |||
76 | PMID29671355-Compound-74 | Drug Info | [4] | |||
77 | PMID29671355-Compound-8 | Drug Info | [4] | |||
78 | PMID29671355-Compound-9 | Drug Info | [4] | |||
79 | Sulfonamide derivative 16 | Drug Info | [5] | |||
80 | (E)-8-Biphenyl-4-yl-1-oxazol-2-yl-oct-7-en-1-one | Drug Info | [6] | |||
81 | (S)-2-Amino-N-cyclopentyl-7-mercaptoheptanamide | Drug Info | [7] | |||
82 | 2-(methylsulfonylthio)ethyl 2-propylpentanoate | Drug Info | [8] | |||
83 | 4-Benzoylamino-N-hydroxy-benzamide | Drug Info | [9] | |||
84 | 4-Butyrylamino-N-hydroxy-benzamide | Drug Info | [10] | |||
85 | 4-Chloro-N-(5-hydroxycarbamoyl-pentyl)-benzamide | Drug Info | [11] | |||
86 | 4-Dimethylamino-N-(6-mercapto-hexyl)-benzamide | Drug Info | [12] | |||
87 | 4-Hydroxy-N-(5-hydroxycarbamoyl-pentyl)-benzamide | Drug Info | [13] | |||
88 | 4-Phenylbutyrohydroxamic acid | Drug Info | [14] | |||
89 | 5-(4-Chloro-phenyl)-pentanoic acid hydroxyamide | Drug Info | [15] | |||
90 | 5-(4-hydroxyphenyl)-3H-1,2-dithiole-3-thione | Drug Info | [8] | |||
91 | 5-Mercapto-pentanoic acid phenylamide | Drug Info | [12] | |||
92 | 6-(2-Bromo-acetylamino)-hexanoic acid phenylamide | Drug Info | [12] | |||
93 | 6-(9H-carbazol-9-yl)-N-hydroxyhexanamide | Drug Info | [16] | |||
94 | 6-benzenesulfinylhexanoic acid hydroxamide | Drug Info | [17] | |||
95 | 6-benzenesulfonylhexanoic acid hydroxamide | Drug Info | [17] | |||
96 | 6-Mercapto-hexanoic acid phenylamide | Drug Info | [12] | |||
97 | 6-Phenoxy-hexane-1-thiol | Drug Info | [12] | |||
98 | 6-phenylsulfanylhexanoic acid hydroxamide | Drug Info | [17] | |||
99 | 7-(Biphenyl-3-yloxy)-1-oxazol-2-yl-heptan-1-one | Drug Info | [6] | |||
100 | 7-(Biphenyl-4-yloxy)-1,1,1-trifluoro-heptan-2-one | Drug Info | [11] | |||
101 | 7-(Biphenyl-4-yloxy)-1-oxazol-2-yl-heptan-1-one | Drug Info | [6] | |||
102 | 7-(Naphthalen-2-yloxy)-1-oxazol-2-yl-heptan-1-one | Drug Info | [6] | |||
103 | 7-Mercapto-heptanoic acid benzothiazol-2-ylamide | Drug Info | [12] | |||
104 | 7-Mercapto-heptanoic acid biphenyl-3-ylamide | Drug Info | [12] | |||
105 | 7-Mercapto-heptanoic acid biphenyl-4-ylamide | Drug Info | [12] | |||
106 | 7-Mercapto-heptanoic acid phenylamide | Drug Info | [12] | |||
107 | 7-Mercapto-heptanoic acid pyridin-3-ylamide | Drug Info | [12] | |||
108 | 7-Mercapto-heptanoic acid quinolin-3-ylamide | Drug Info | [12] | |||
109 | 7-mercapto-N-(4-phenylthiazol-2-yl)heptanamide | Drug Info | [7] | |||
110 | 8-(Biphenyl-4-yloxy)-1,1,1-trifluoro-octan-2-one | Drug Info | [6] | |||
111 | 8-Mercapto-octanoic acid phenylamide | Drug Info | [12] | |||
112 | 8-Oxo-8-phenyl-octanoic acid | Drug Info | [13] | |||
113 | 8-Oxo-8-phenyl-octanoic acid hydroxyamide | Drug Info | [11] | |||
114 | 9,9,9-Trifluoro-8-oxo-nonanoic acid phenylamide | Drug Info | [11] | |||
115 | 9-(Biphenyl-4-yloxy)-1,1,1-trifluoro-nonan-2-one | Drug Info | [11] | |||
116 | Cyclo(-L-Am7(S2Py)-A2in-L-Ala-D-Pro-) | Drug Info | [18] | |||
117 | Cyclo(-L-Am7(S2Py)-Aib-L-Ala-D-Pro-) | Drug Info | [18] | |||
118 | Cyclo(-L-Am7(S2Py)-Aib-L-Ala-D-Tic-) | Drug Info | [18] | |||
119 | Cyclo(-L-Am7(S2Py)-Aib-L-Ph4-D-Pro-) | Drug Info | [18] | |||
120 | Cyclo(-L-Am7(S2Py)-Aib-L-Ph5-D-Pro-) | Drug Info | [18] | |||
121 | Cyclo(-L-Am7(S2Py)-Aib-L-Phe-D-Pro-) | Drug Info | [18] | |||
122 | Cyclo(-L-Am7(S2Py)-Aib-L-Phg-D-Pro-) | Drug Info | [18] | |||
123 | Cyclo(-L-Am7(S2Py)-Aib-L-Ser(Bzl)-D-Pro-) | Drug Info | [18] | |||
124 | Cyclo(-L-Am7(S2Py)-Aib-L-Ser-D-Pro-) | Drug Info | [18] | |||
125 | Cyclo(-L-Am7(S2Py)-D-2MePhe-L-Ala-D-Pro-) | Drug Info | [18] | |||
126 | Cyclo(-L-Am7(S2Py)-D-A1in-L-Ala-D-Pro-) | Drug Info | [18] | |||
127 | Cyclo(-L-Am7(S2Py)-L-2MePhe-L-Ala-D-Pro-) | Drug Info | [18] | |||
128 | Cyclo(-L-Am7(S2Py)-L-A1in-L-Ala-D-Pro-) | Drug Info | [18] | |||
129 | Cyclostellettamine derivative | Drug Info | [19] | |||
130 | droxinostat | Drug Info | [20] | |||
131 | IKH-25 | Drug Info | [21] | |||
132 | N-(2-Mercapto-ethyl)-N'-phenyl-oxalamide | Drug Info | [22] | |||
133 | N-(2-Mercapto-ethyl)-N'-phenyl-succinamide | Drug Info | [22] | |||
134 | N-(5-Hydroxycarbamoyl-pentyl)-4-nitro-benzamide | Drug Info | [11] | |||
135 | N-(6-Hydroxycarbamoyl-hexyl)-benzamide | Drug Info | [13] | |||
136 | N-(6-Mercapto-hexyl)-benzamide | Drug Info | [12] | |||
137 | N-(biphenyl-3-yl)-6-(sulfamoylamino)hexanamide | Drug Info | [23] | |||
138 | N-(quinolin-3-yl)-6-(sulfamoylamino)hexanamide | Drug Info | [23] | |||
139 | N-(quinolin-6-yl)-6-(sulfamoylamino)hexanamide | Drug Info | [23] | |||
140 | N-(quinolin-8-yl)-6-(sulfamoylamino)hexanamide | Drug Info | [23] | |||
141 | N-Hydroxy-4-((R)-2-phenyl-butyrylamino)-benzamide | Drug Info | [9] | |||
142 | N-Hydroxy-4-((S)-2-phenyl-butyrylamino)-benzamide | Drug Info | [9] | |||
143 | N-Hydroxy-4-(2-phenyl-butyrylamino)-benzamide | Drug Info | [9] | |||
144 | N-Hydroxy-4-(3-phenyl-propionylamino)-benzamide | Drug Info | [9] | |||
145 | N-Hydroxy-4-(4-phenyl-butyrylamino)-benzamide | Drug Info | [9] | |||
146 | N-Hydroxy-4-(5-phenyl-pentanoylamino)-benzamide | Drug Info | [9] | |||
147 | N-Hydroxy-4-(pentanoylamino-methyl)-benzamide | Drug Info | [10] | |||
148 | N-Hydroxy-4-(phenylacetylamino-methyl)-benzamide | Drug Info | [10] | |||
149 | N-Hydroxy-4-phenylacetylamino-benzamide | Drug Info | [9] | |||
150 | N-phenyl-6-(sulfamoylamino)hexanamide | Drug Info | [23] | |||
151 | N-[5-(Formyl-hydroxy-amino)-pentyl]-benzamide | Drug Info | [24] | |||
152 | N1-(biphenyl-3-yl)-N8-hydroxyoctanediamide | Drug Info | [23] | |||
153 | N1-(biphenyl-4-yl)-N8-hydroxyoctanediamide | Drug Info | [25] | |||
154 | N1-hydroxy-N8-(4-phenylthiazol-2-yl)octanediamide | Drug Info | [25] | |||
155 | nexturastat A | Drug Info | [26] | |||
156 | NILTUBACIN | Drug Info | [14] | |||
157 | NQN-1 | Drug Info | [27] | |||
158 | Octanedioic acid bis-hydroxyamide | Drug Info | [28] | |||
159 | Octanedioic acid hydroxyamide pyridin-2-ylamide | Drug Info | [13] | |||
160 | Octanedioic acid hydroxyamide pyridin-4-ylamide | Drug Info | [13] | |||
161 | PMID19111466C7d | Drug Info | [29] | |||
162 | PMID20947351C16 | Drug Info | [16] | |||
163 | PSAMMAPLIN A | Drug Info | [11] | |||
164 | santacruzamate A | Drug Info | [30] | |||
165 | ST-2741 | Drug Info | [31] | |||
166 | ST-2986 | Drug Info | [32] | |||
167 | ST-2987 | Drug Info | [32] | |||
168 | ST-3050 | Drug Info | [32] | |||
169 | Thioacetic acid S-(6-phenylcarbamoyl-hexyl) ester | Drug Info | [12] | |||
170 | Tubacin | Drug Info | [33], [34] | |||
171 | UCL-67022 | Drug Info | [21] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) | ||||||
Drug Resistance Mutation (DRM) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | Alcoholism | |||||
2 | Viral carcinogenesis | |||||
PID Pathway | [+] 2 PID Pathways | + | ||||
1 | Signaling events mediated by HDAC Class II | |||||
2 | Signaling events mediated by HDAC Class I | |||||
Reactome | [+] 4 Reactome Pathways | + | ||||
1 | NOTCH1 Intracellular Domain Regulates Transcription | |||||
2 | Constitutive Signaling by NOTCH1 PEST Domain Mutants | |||||
3 | Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants | |||||
4 | Assembly of the primary cilium | |||||
WikiPathways | [+] 3 WikiPathways | + | ||||
1 | Ectoderm Differentiation | |||||
2 | Neural Crest Differentiation | |||||
3 | Cell Cycle |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Promising therapies in multiple myeloma. Blood. 2015 July 16; 126(3): 300-310. | |||||
REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 3 | Novel histone deacetylase 6 (HDAC6) selective inhibitors: a patent evaluation (WO2014181137).Expert Opin Ther Pat. 2017 Mar;27(3):229-236. | |||||
REF 4 | HDAC inhibitors: a 2013-2017 patent survey.Expert Opin Ther Pat. 2018 Apr 19:1-17. | |||||
REF 5 | Sulfonamide inhibitors: a patent review 2013-present.Expert Opin Ther Pat. 2018 Jul;28(7):541-549. | |||||
REF 6 | Heterocyclic ketones as inhibitors of histone deacetylase. Bioorg Med Chem Lett. 2003 Nov 17;13(22):3909-13. | |||||
REF 7 | Design, synthesis, structure--selectivity relationship, and effect on human cancer cells of a novel series of histone deacetylase 6-selective inhib... J Med Chem. 2007 Nov 1;50(22):5425-38. | |||||
REF 8 | New sulfurated derivatives of valproic acid with enhanced histone deacetylase inhibitory activity. Bioorg Med Chem Lett. 2008 Mar 15;18(6):1893-7. | |||||
REF 9 | Structure-based optimization of phenylbutyrate-derived histone deacetylase inhibitors. J Med Chem. 2005 Aug 25;48(17):5530-5. | |||||
REF 10 | Zn2+-chelating motif-tethered short-chain fatty acids as a novel class of histone deacetylase inhibitors. J Med Chem. 2004 Jan 15;47(2):467-74. | |||||
REF 11 | Histone deacetylase inhibitors. J Med Chem. 2003 Nov 20;46(24):5097-116. | |||||
REF 12 | Novel inhibitors of human histone deacetylases: design, synthesis, enzyme inhibition, and cancer cell growth inhibition of SAHA-based non-hydroxama... J Med Chem. 2005 Feb 24;48(4):1019-32. | |||||
REF 13 | Inhibitors of human histone deacetylase: synthesis and enzyme and cellular activity of straight chain hydroxamates. J Med Chem. 2002 Feb 14;45(4):753-7. | |||||
REF 14 | Chemical phylogenetics of histone deacetylases. Nat Chem Biol. 2010 Mar;6(3):238-243. | |||||
REF 15 | Stereodefined and polyunsaturated inhibitors of histone deacetylase based on (2E,4E)-5-arylpenta-2,4-dienoic acid hydroxyamides. Bioorg Med Chem Lett. 2004 May 17;14(10):2477-81. | |||||
REF 16 | Inhibitors selective for HDAC6 in enzymes and cells. Bioorg Med Chem Lett. 2010 Dec 1;20(23):7067-70. | |||||
REF 17 | Aromatic sulfide inhibitors of histone deacetylase based on arylsulfinyl-2,4-hexadienoic acid hydroxyamides. J Med Chem. 2006 Jan 26;49(2):800-5. | |||||
REF 18 | Molecular design of histone deacetylase inhibitors by aromatic ring shifting in chlamydocin framework. Bioorg Med Chem. 2007 Dec 15;15(24):7830-9. | |||||
REF 19 | Three new cyclostellettamines, which inhibit histone deacetylase, from a marine sponge of the genus Xestospongia. Bioorg Med Chem Lett. 2004 May 17;14(10):2617-20. | |||||
REF 20 | Selective inhibition of histone deacetylases sensitizes malignant cells to death receptor ligands. Mol Cancer Ther. 2010 Jan;9(1):246-56. | |||||
REF 21 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2618). | |||||
REF 22 | Mercaptoamide-based non-hydroxamic acid type histone deacetylase inhibitors. Bioorg Med Chem Lett. 2005 Apr 15;15(8):1969-72. | |||||
REF 23 | Sulfamides as novel histone deacetylase inhibitors. Bioorg Med Chem Lett. 2009 Jan 15;19(2):336-40. | |||||
REF 24 | Design, synthesis, and activity of HDAC inhibitors with a N-formyl hydroxylamine head group. Bioorg Med Chem Lett. 2004 Jan 19;14(2):449-53. | |||||
REF 25 | Isoxazole moiety in the linker region of HDAC inhibitors adjacent to the Zn-chelating group: effects on HDAC biology and antiproliferative activity. Bioorg Med Chem Lett. 2009 Jun 1;19(11):3023-6. | |||||
REF 26 | Selective histone deacetylase 6 inhibitors bearing substituted urea linkers inhibit melanoma cell growth. J Med Chem. 2012 Nov 26;55(22):9891-9. | |||||
REF 27 | A novel class of small molecule inhibitors of HDAC6. ACS Chem Biol. 2012 Feb 17;7(2):331-9. | |||||
REF 28 | Structure-activity relationships on phenylalanine-containing inhibitors of histone deacetylase: in vitro enzyme inhibition, induction of differenti... J Med Chem. 2002 Jul 18;45(15):3296-309. | |||||
REF 29 | Novel HDAC6 isoform selective chiral small molecule histone deacetylase inhibitors. Bioorg Med Chem Lett. 2009 Feb 1;19(3):688-92. | |||||
REF 30 | Santacruzamate A, a potent and selective histone deacetylase inhibitor from the Panamanian marine cyanobacterium cf. Symploca sp. J Nat Prod. 2013 Nov 22;76(11):2026-33. | |||||
REF 31 | Exploring bis-(indolyl)methane moiety as an alternative and innovative CAP group in the design of histone deacetylase (HDAC) inhibitors. Bioorg Med Chem Lett. 2009 May 15;19(10):2840-3. | |||||
REF 32 | N-Hydroxy-(4-oxime)-cinnamide: a versatile scaffold for the synthesis of novel histone deacetylase [correction of deacetilase] (HDAC) inhibitors. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2346-9. | |||||
REF 33 | Emerging therapies for multiple myeloma. Expert Opin Emerg Drugs. 2009 Mar;14(1):99-127. | |||||
REF 34 | Anticancer activities of histone deacetylase inhibitors. Nat Rev Drug Discov. 2006 Sep;5(9):769-84. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.