Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T28722
(Former ID: TTDI01774)
|
|||||
Target Name |
GABA(A) receptor gamma-3 (GABRG3)
|
|||||
Synonyms |
GABRG3
|
|||||
Gene Name |
GABRG3
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 9 Target-related Diseases | + | ||||
1 | Anxiety disorder [ICD-11: 6B00-6B0Z] | |||||
2 | Corneal disease [ICD-11: 9A76-9A78] | |||||
3 | Depression [ICD-11: 6A70-6A7Z] | |||||
4 | Epilepsy/seizure [ICD-11: 8A61-8A6Z] | |||||
5 | Insomnia [ICD-11: 7A00-7A0Z] | |||||
6 | Intentional self-harm [ICD-11: PC91] | |||||
7 | Labour/delivery anaesthesia complication [ICD-11: JB0C] | |||||
8 | Mental/behavioural/neurodevelopmental disorder [ICD-11: 6E20-6E8Z] | |||||
9 | Mood/affect symptom [ICD-11: MB24] | |||||
Function |
Component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functionsas receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand- gated chloride channel.
Click to Show/Hide
|
|||||
BioChemical Class |
Ligand-gated ion channel
|
|||||
UniProt ID | ||||||
Sequence |
MAPKLLLLLCLFSGLHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDK
KLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNS NMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPM DEHSCPLIFSSYGYPKEEMIYRWRKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDY VVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLS TIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYYSSCRKPTTTKKTTSLLHPDS SRWIPERISLQAPSNYSLLDMRPPPTAMITLNNSVYWQEFEDTCVYECLDGKDCQSFFCC YEECKSGSWRKGRIHIDILELDSYSRVFFPTSFLLFNLVYWVGYLYL Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 12 Approved Drugs | + | ||||
1 | Allopregnanolone | Drug Info | Approved | Postpartum depression | [2], [3] | |
2 | Bentazepam | Drug Info | Approved | Anxiety disorder | [4] | |
3 | Clobazam - Lundbeck | Drug Info | Approved | Anxiety disorder | [5], [6] | |
4 | Etomidate | Drug Info | Approved | Anaesthesia | [7], [8] | |
5 | Flumazenil | Drug Info | Approved | Benzodiazepine overdose | [9], [10] | |
6 | Mebutamate | Drug Info | Approved | Anxiety disorder | [4] | |
7 | Metharbital | Drug Info | Approved | Epilepsy | [11], [12] | |
8 | Remimazolam | Drug Info | Approved | Procedural sedation | [13] | |
9 | Stiripentol | Drug Info | Approved | Dravet syndrome | [14] | |
10 | Talbutal | Drug Info | Approved | Irritability | [15] | |
11 | Thiamylal | Drug Info | Approved | Anaesthesia | [16], [17] | |
12 | Zolpidem | Drug Info | Approved | Insomnia | [4], [18] | |
Clinical Trial Drug(s) | [+] 12 Clinical Trial Drugs | + | ||||
1 | Arbaclofen placarbil | Drug Info | Phase 3 | Fragile X syndrome | [19] | |
2 | Clomethiazole | Drug Info | Phase 3 | Stroke | [20] | |
3 | Ganaxolone | Drug Info | Phase 3 | Complex partial seizure | [21] | |
4 | SAGE-217 | Drug Info | Phase 3 | Postpartum depression | [22] | |
5 | Pagoclone | Drug Info | Phase 2/3 | Anxiety disorder | [23] | |
6 | Etazolate | Drug Info | Phase 2 | Neurodegenerative disorder | [24], [25] | |
7 | EVT-201 | Drug Info | Phase 2 | Insomnia | [26] | |
8 | SARIPIDEM | Drug Info | Phase 2 | Anxiety disorder | [27] | |
9 | T-2007 | Drug Info | Phase 2 | Epilepsy | [28] | |
10 | AZD-3043 | Drug Info | Phase 1 | Anaesthesia | [29] | |
11 | NSD-788 | Drug Info | Phase 1 | Anxiety disorder | [30] | |
12 | Org-25435 | Drug Info | Phase 1 | Epilepsy | [31] | |
Discontinued Drug(s) | [+] 21 Discontinued Drugs | + | ||||
1 | Suriclone | Drug Info | Discontinued in Preregistration | Anxiety disorder | [32] | |
2 | Ocinaplon | Drug Info | Discontinued in Phase 3 | Generalized anxiety disorder | [33], [34] | |
3 | Pazinaclone | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [35] | |
4 | Y-23684 | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [36] | |
5 | LORECLEZOLE | Drug Info | Discontinued in Phase 2 | Epileptic seizures | [37], [38] | |
6 | NGD 91-3 | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [39] | |
7 | RESEQUINIL | Drug Info | Discontinued in Phase 2 | Epilepsy | [40] | |
8 | RO-48-6791 | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [41] | |
9 | SL-65.1498 | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [42] | |
10 | Suritozole | Drug Info | Discontinued in Phase 2 | Major depressive disorder | [43] | |
11 | CCD-3693 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [44] | |
12 | CTP-354 | Drug Info | Discontinued in Phase 1 | Pain | [45] | |
13 | Org-21465 | Drug Info | Discontinued in Phase 1 | Anaesthesia | [46] | |
14 | RO-48-8684 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [47] | |
15 | Co-152791 | Drug Info | Terminated | Epilepsy | [49] | |
16 | Girisopam | Drug Info | Terminated | Anxiety disorder | [50] | |
17 | NSD-721 | Drug Info | Terminated | Anxiety disorder | [51] | |
18 | Ro-19-8022 | Drug Info | Terminated | Anxiety disorder | [52] | |
19 | RU-33965 | Drug Info | Terminated | Alzheimer disease | [53] | |
20 | ZK-91296 | Drug Info | Terminated | Alzheimer disease | [54] | |
21 | ZK-93426 | Drug Info | Terminated | Alzheimer disease | [55], [56] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | RWJ-51204 | Drug Info | Preclinical | Anxiety disorder | [48] | |
Mode of Action | [+] 5 Modes of Action | + | ||||
Modulator | [+] 48 Modulator drugs | + | ||||
1 | Allopregnanolone | Drug Info | [3], [57] | |||
2 | Bentazepam | Drug Info | [1], [4] | |||
3 | Clobazam - Lundbeck | Drug Info | [58] | |||
4 | Etomidate | Drug Info | [58] | |||
5 | Mebutamate | Drug Info | [58] | |||
6 | Metharbital | Drug Info | [58] | |||
7 | Stiripentol | Drug Info | [4], [60] | |||
8 | Talbutal | Drug Info | [58] | |||
9 | Thiamylal | Drug Info | [58] | |||
10 | Clomethiazole | Drug Info | [61] | |||
11 | SAGE-217 | Drug Info | [3], [57] | |||
12 | Pagoclone | Drug Info | [63] | |||
13 | Etazolate | Drug Info | [25] | |||
14 | EVT-201 | Drug Info | [59] | |||
15 | SARIPIDEM | Drug Info | [27] | |||
16 | AZD-3043 | Drug Info | [64] | |||
17 | NSD-788 | Drug Info | [59] | |||
18 | Org-25435 | Drug Info | [65] | |||
19 | Suriclone | Drug Info | [66] | |||
20 | Ocinaplon | Drug Info | [67] | |||
21 | Pazinaclone | Drug Info | [68] | |||
22 | Y-23684 | Drug Info | [69] | |||
23 | LORECLEZOLE | Drug Info | [70] | |||
24 | RO-48-6791 | Drug Info | [73] | |||
25 | Suritozole | Drug Info | [75] | |||
26 | CCD-3693 | Drug Info | [76] | |||
27 | CTP-354 | Drug Info | [77] | |||
28 | Org-21465 | Drug Info | [78] | |||
29 | RO-48-8684 | Drug Info | [79] | |||
30 | RWJ-51204 | Drug Info | [80] | |||
31 | Co-152791 | Drug Info | [81] | |||
32 | Girisopam | Drug Info | [82] | |||
33 | NSD-721 | Drug Info | [59] | |||
34 | Ro-19-8022 | Drug Info | [83] | |||
35 | RU-33965 | Drug Info | [84], [85], [86] | |||
36 | ZK-91296 | Drug Info | [87] | |||
37 | ZK-93426 | Drug Info | [88] | |||
38 | AA-29504 | Drug Info | [59] | |||
39 | C-21191 | Drug Info | [59] | |||
40 | CP-409092 | Drug Info | [89] | |||
41 | DOV-51892 | Drug Info | [59] | |||
42 | GIDAZEPAM | Drug Info | [90] | |||
43 | HZ-166 | Drug Info | [59] | |||
44 | NGD 96-3 | Drug Info | [59] | |||
45 | PNU 101017 | Drug Info | [91] | |||
46 | Ro-15-3505 | Drug Info | [92] | |||
47 | UC-2024 | Drug Info | [59] | |||
48 | UC-2029 | Drug Info | [59] | |||
Modulator (allosteric modulator) | [+] 10 Modulator (allosteric modulator) drugs | + | ||||
1 | Flumazenil | Drug Info | [59] | |||
2 | Zolpidem | Drug Info | [59] | |||
3 | alpha3IA | Drug Info | [59] | |||
4 | alpha5IA | Drug Info | [59] | |||
5 | DMCM | Drug Info | [59] | |||
6 | tetrahydrodeoxycorticosterone | Drug Info | [59] | |||
7 | TP003 | Drug Info | [59] | |||
8 | [18F]fluoroethylflumazenil | Drug Info | [59] | |||
9 | [3H]CGS8216 | Drug Info | [59] | |||
10 | [3H]Ro154513 | Drug Info | [59] | |||
Agonist | [+] 10 Agonist drugs | + | ||||
1 | Remimazolam | Drug Info | [13] | |||
2 | Arbaclofen placarbil | Drug Info | [3] | |||
3 | Ganaxolone | Drug Info | [3], [57], [62] | |||
4 | T-2007 | Drug Info | [59] | |||
5 | NGD 91-3 | Drug Info | [71] | |||
6 | RESEQUINIL | Drug Info | [72] | |||
7 | SL-65.1498 | Drug Info | [74] | |||
8 | isonipecotic acid | Drug Info | [59] | |||
9 | JM-1232(-) | Drug Info | [59] | |||
10 | piperidine-4-sulphonic acid | Drug Info | [59] | |||
Blocker (channel blocker) | [+] 2 Blocker (channel blocker) drugs | + | ||||
1 | TBPS | Drug Info | [59] | |||
2 | [35S]TBPS | Drug Info | [59] | |||
Antagonist | [+] 1 Antagonist drugs | + | ||||
1 | UC-1011 | Drug Info | [59] |
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 5 KEGG Pathways | + | ||||
1 | Neuroactive ligand-receptor interaction | |||||
2 | Retrograde endocannabinoid signaling | |||||
3 | GABAergic synapse | |||||
4 | Morphine addiction | |||||
5 | Nicotine addiction | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Ligand-gated ion channel transport | |||||
2 | GABA A receptor activation | |||||
WikiPathways | [+] 3 WikiPathways | + | ||||
1 | SIDS Susceptibility Pathways | |||||
2 | Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
3 | Iron uptake and transport |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Prodynorphin gene deletion increased anxiety-like behaviours, impaired the anxiolytic effect of bromazepam and altered GABAA receptor subunits gene expression in the amygdala. J Psychopharmacol. 2011Jan;25(1):87-96. | |||||
REF 2 | Antibodies and venom peptides: new modalities for ion channels. Nat Rev Drug Discov. 2019 May;18(5):339-357. | |||||
REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7149). | |||||
REF 6 | Drug information of Clobazam, 2008. eduDrugs. | |||||
REF 7 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5463). | |||||
REF 8 | Anaesthetic drugs: linking molecular actions to clinical effects. Curr Pharm Des. 2006;12(28):3665-79. | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4192). | |||||
REF 10 | ClinicalTrials.gov (NCT00997087) A Randomized, Double-Blind, Placebo-Controlled Trial of Flumazenil for the Treatment of Obsessive Compulsive Disorder. U.S. National Institutes of Health. | |||||
REF 11 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7230). | |||||
REF 12 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 008322. | |||||
REF 13 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020 | |||||
REF 14 | The effects of stiripentol on GABA(A) receptors.Epilepsia. 2011 Apr;52 Suppl 2:76-8. | |||||
REF 15 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 009410. | |||||
REF 16 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7305). | |||||
REF 17 | Drug information of Thiamylal, 2008. eduDrugs. | |||||
REF 18 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4348). | |||||
REF 19 | ClinicalTrials.gov (NCT01325220) Efficacy and Safety Study of STX209 (Arbaclofen) for the Treatment of Social Withdrawal in Children With Fragile X Syndrome. U.S. National Institutes of Health. | |||||
REF 20 | ClinicalTrials.gov (NCT02374567) Pharmacovigilance in Gerontopsychiatric Patients. U.S. National Institutes of Health. | |||||
REF 21 | ClinicalTrials.gov (NCT01963208) Phase 3 Study of Adjunctive Ganaxolone in Adults With Drug-resistant Partial Onset Seizures and Open-label Extension. U.S. National Institutes of Health. | |||||
REF 22 | ClinicalTrials.gov (NCT04442503) A Study to Evaluate the Efficacy and Safety of SAGE-217 in Participants With Severe Postpartum Depression (PPD). U.S. National Institutes of Health. | |||||
REF 23 | ClinicalTrials.gov (NCT00830154) A Study to Assess the Efficacy and Safety of Pagoclone for Adults With Stuttering. U.S. National Institutes of Health. | |||||
REF 24 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7336). | |||||
REF 25 | Etazolate, a neuroprotective drug linking GABA(A) receptor pharmacology to amyloid precursor protein processing. J Neurochem. 2008 Jul;106(1):392-404. | |||||
REF 26 | ClinicalTrials.gov (NCT00380003) Efficacy Study of EVT 201 to Treat Insomnia. U.S. National Institutes of Health. | |||||
REF 27 | Behavioural effects of novel benzodiazepine (omega) receptor agonists and partial agonists: increases in punished responding and antagonism of the pentylenetetrazole cue. Behav Pharmacol. 1995 Mar;6(2):116-126. | |||||
REF 28 | ClinicalTrials.gov (NCT00939653) T2007-002 Clofarabine, Etoposide, Cyclophosphamide in Relapsed Acute Myelogenous Leukemia (AML). U.S. National Institutes of Health. | |||||
REF 29 | ClinicalTrials.gov (NCT01086813) Phase I, Single Centre, Study to Assess Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of AZD3043. U.S. National Institutes of Health. | |||||
REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028006) | |||||
REF 31 | ClinicalTrials.gov (NCT01062867) First Administration to Man Of Org 25435 a New Intravenous Anesthetic. U.S. National Institutes of Health. | |||||
REF 32 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000574) | |||||
REF 33 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4277). | |||||
REF 34 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001407) | |||||
REF 35 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000717) | |||||
REF 36 | The pharmacological properties of Y-23684, a benzodiazepine receptor partial agonist.. Br J Pharmacol. 1994 April; 111(4): 1170-1178. | |||||
REF 37 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5466). | |||||
REF 38 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007906) | |||||
REF 39 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011480) | |||||
REF 40 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010724) | |||||
REF 41 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007556) | |||||
REF 42 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014726) | |||||
REF 43 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001322) | |||||
REF 44 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006723) | |||||
REF 45 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800038187) | |||||
REF 46 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006459) | |||||
REF 47 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007572) | |||||
REF 48 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015754) | |||||
REF 49 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011029) | |||||
REF 50 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005437) | |||||
REF 51 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010233) | |||||
REF 52 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001584) | |||||
REF 53 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001729) | |||||
REF 54 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000552) | |||||
REF 55 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4347). | |||||
REF 56 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001474) | |||||
REF 57 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 58 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 59 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 415). | |||||
REF 60 | Stiripentol, a putative antiepileptic drug, enhances the duration of opening of GABA-A receptor channels. Epilepsia. 2006 Apr;47(4):704-16. | |||||
REF 61 | Electrophysiological actions of gamma-aminobutyric acid and clomethiazole on recombinant GABA(A) receptors. Eur J Pharmacol. 2002 Oct 11;452(3):255-62. | |||||
REF 62 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 63 | Evaluation of the abuse potential of pagoclone, a partial GABAA agonist. J Clin Psychopharmacol. 2006 Jun;26(3):268-73. | |||||
REF 64 | AZD-3043: a novel, metabolically labile sedative-hypnotic agent with rapid and predictable emergence from hypnosis. Anesthesiology. 2012 Jun;116(6):1267-77. | |||||
REF 65 | First administration to man of Org 25435, an intravenous anaesthetic: A Phase 1 Clinical Trial. BMC Anesthesiol. 2010 Jun 29;10:10. | |||||
REF 66 | The effect of cyclopyrrolones on GABAA receptor function is different from that of benzodiazepines. Naunyn Schmiedebergs Arch Pharmacol. 1994 Sep;350(3):294-300. | |||||
REF 67 | Discriminative stimulus properties of GABAA receptor positive allosteric modulators TPA023, ocinaplon and NG2-73 in rats trained to discriminate chlordiazepoxide or zolpidem. Eur J Pharmacol. 2011 Oct 1;668(1-2):190-3. | |||||
REF 68 | The benzodiazepine binding site of GABA(A) receptors as a target for the development of novel anxiolytics. Expert Opin Investig Drugs. 2005 May;14(5):601-18. | |||||
REF 69 | The pharmacological properties of Y-23684, a benzodiazepine receptor partial agonist. Br J Pharmacol. 1994 Apr;111(4):1170-8. | |||||
REF 70 | Direct activation of GABAA receptors by loreclezole, an anticonvulsant drug with selectivity for the beta-subunit. Neuropharmacology. 1996;35(12):1753-60. | |||||
REF 71 | Anxioselective compounds acting at the GABA(A) receptor benzodiazepine binding site. Curr Drug Targets CNS Neurol Disord. 2003 Aug;2(4):213-32. | |||||
REF 72 | WO patent application no. 2010,0024,51, Naphthyridin derivatives. | |||||
REF 73 | Integrated pharmacokinetics and pharmacodynamics of Ro 48-6791, a new benzodiazepine, in comparison with midazolam during first administration to healthy male subjects. Br J Clin Pharmacol. 1997 Nov;44(5):477-86. | |||||
REF 74 | WO patent application no. 2005,0749,31, Pharmaceutical combinations comprising (s) -pantoprazole. | |||||
REF 75 | Chronic postinjury administration of MDL 26,479 (Suritozole), a negative modulator at the GABAA receptor, and cognitive impairment in rats following traumatic brain injury. J Neurosurg. 1995 Nov;83(5):878-83. | |||||
REF 76 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
REF 77 | Clinical pipeline report, company report or official report of Concert Pharmaceuticals. | |||||
REF 78 | Computer-controlled infusion of ORG 21465, a water soluble steroid i.v. anaesthetic agent, into human volunteers. Br J Anaesth. 1997 Oct;79(4):433-9. | |||||
REF 79 | Integrated pharmacokinetics and pharmacodynamics of Ro 48-8684, a new benzodiazepine, in comparison with midazolam during first administration to healthy male subjects. Br J Clin Pharmacol. 1997 Nov;44(5):487-93. | |||||
REF 80 | 5-ethoxymethyl-7-fluoro-3-oxo-1,2,3,5-tetrahydrobenzo[4,5]imidazo[1,2a]pyridine-4-N-(2-fluorophenyl)carboxamide (RWJ-51204), a new nonbenzodiazepine anxiolytic. J Pharmacol Exp Ther. 2002 Nov;303(2):777-90. | |||||
REF 81 | Substituted 3beta-phenylethynyl derivatives of 3alpha-hydroxy-5alpha-pregnan-20-one: remarkably potent neuroactive steroid modulators of gamma-aminobutyric acidA receptors. J Pharmacol Exp Ther. 1998Oct;287(1):198-207. | |||||
REF 82 | [(3)H]-girisopam, a novel selective benzodiazepine for the 2, 3-benzodiazepine binding site. Brain Res Brain Res Protoc. 1999 Jul;4(2):230-5. | |||||
REF 83 | Partial agonist of benzodiazepine receptors Ro 19-8022 elicits withdrawal symptoms after short-term administration in immature rats. Physiol Res. 2012;61(3):319-23. | |||||
REF 84 | Discriminative stimulus properties of RU 33965, a benzodiazepine receptor weak partial inverse agonist. Pharmacol Biochem Behav. 1992 Oct;43(2):583-8. | |||||
REF 85 | The effects of RU 33965 and RU 34030, two new 3-cyclopropyl carbonyl imidazobenzodiazepines, on GABAA receptor-mediated synaptic transmission in ce... Gen Pharmacol. 1994 May;25(3):589-97. | |||||
REF 86 | Effects of benzodiazepine receptor inverse agonists and nicotine on behavioral vigilance in senescent rats. J Gerontol A Biol Sci Med Sci. 1996 May;51(3):B225-31. | |||||
REF 87 | Enhancement of gamma-aminobutyric acid binding by the anxiolytic beta-carbolines ZK 93423 and ZK 91296. J Neurochem. 1987 May;48(5):1355-8. | |||||
REF 88 | Actions of the beta-carboline ZK 93426 in an animal test of anxiety and the holeboard: interactions with Ro 15-1788. J Neural Transm. 1986;65(2):103-14. | |||||
REF 89 | The ChEMBL database in 2017. Nucleic Acids Res. 2017 Jan 4;45(D1):D945-D954. | |||||
REF 90 | Discriminative effects of phenazepam and gidazepam in rats: comparison with other GABA-related drugs. Pharmacol Biochem Behav. 1999 Oct;64(2):397-401. | |||||
REF 91 | Neuroprotective effects of the GABA(A) receptor partial agonist U-101017 in 3-acetylpyridine-treated rats. Neurosci Lett. 1997 May 30;228(1):45-9. | |||||
REF 92 | Molecular structure and stereoelectronic properties of sarmazenil--a weak inverse agonist at the omega modulatory sites (benzodiazepine receptors):... Bioorg Med Chem. 1998 Oct;6(10):1745-57. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.