Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T62449
(Former ID: TTDC00005)
|
|||||
| Target Name |
Checkpoint kinase-1 (CHK1)
|
|||||
| Synonyms |
Serine/threonine-protein kinase Chk1; Chk1; Cell cycle checkpoint kinase; CHK1 checkpoint homolog
Click to Show/Hide
|
|||||
| Gene Name |
CHEK1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 8 Target-related Diseases | + | ||||
| 1 | Lung cancer [ICD-11: 2C25] | |||||
| 2 | Ovarian cancer [ICD-11: 2C73] | |||||
| 3 | Pancreatic cancer [ICD-11: 2C10] | |||||
| 4 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| 5 | Anal cancer [ICD-11: 2C00] | |||||
| 6 | Head and neck cancer [ICD-11: 2D42] | |||||
| 7 | Hodgkin lymphoma [ICD-11: 2B30] | |||||
| 8 | Lymphoma [ICD-11: 2A80-2A86] | |||||
| Function |
May also negatively regulate cell cycle progression during unperturbed cell cycles. This regulation is achieved by a number of mechanisms that together help to preserve the integrity of the genome. Recognizes the substrate consensus sequence [R-X-X-S/T]. Binds to and phosphorylates CDC25A, CDC25B and CDC25C. Phosphorylation of CDC25A at 'Ser-178' and 'Thr-507' and phosphorylation of CDC25C at 'Ser-216' creates binding sites for 14-3-3 proteins which inhibit CDC25A and CDC25C. Phosphorylation of CDC25A at 'Ser-76', 'Ser-124', 'Ser-178', 'Ser-279' and 'Ser-293' promotes proteolysis of CDC25A. Phosphorylation of CDC25A at 'Ser-76' primes the protein for subsequent phosphorylation at 'Ser-79', 'Ser-82' and 'Ser-88' by NEK11, which is required for polyubiquitination and degradation of CDCD25A. Inhibition of CDC25 leads to increased inhibitory tyrosine phosphorylation of CDK-cyclin complexes and blocks cell cycle progression. Also phosphorylates NEK6. Binds to and phosphorylates RAD51 at 'Thr-309', which promotes the release of RAD51 from BRCA2 and enhances the association of RAD51 with chromatin, thereby promoting DNA repair by homologous recombination. Phosphorylates multiple sites within the C-terminus of TP53, which promotes activation of TP53 by acetylation and promotes cell cycle arrest and suppression of cellular proliferation. Also promotes repair of DNA cross-links through phosphorylation of FANCE. Binds to and phosphorylates TLK1 at 'Ser-743', which prevents the TLK1-dependent phosphorylation of the chromatin assembly factor ASF1A. This may enhance chromatin assembly both in the presence or absence of DNA damage. May also play a role in replication fork maintenance through regulation of PCNA. May regulate the transcription of genes that regulate cell-cycle progression through the phosphorylation of histones. Phosphorylates histone H3. 1 (to form H3T11ph), which leads to epigenetic inhibition of a subset of genes. May also phosphorylate RB1 to promote its interaction with the E2F family of transcription factors and subsequent cell cycle arrest. Serine/threonine-protein kinase which is required for checkpoint-mediated cell cycle arrest and activation of DNA repair in response to the presence of DNA damage or unreplicated DNA.
Click to Show/Hide
|
|||||
| BioChemical Class |
Kinase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 2.7.11.1
|
|||||
| Sequence |
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T11BL5 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 9 Clinical Trial Drugs | + | ||||
| 1 | LY2603618 | Drug Info | Phase 2 | Pancreatic cancer | [2], [3] | |
| 2 | LY2606368 | Drug Info | Phase 2 | Ovarian cancer | [4] | |
| 3 | SCH-900776 | Drug Info | Phase 2 | Solid tumour/cancer | [5], [6] | |
| 4 | UCN-01 | Drug Info | Phase 2 | Non-small-cell lung cancer | [7] | |
| 5 | LY2880070 | Drug Info | Phase 1/2 | Solid tumour/cancer | [8] | |
| 6 | AZD7762 | Drug Info | Phase 1 | Solid tumour/cancer | [9], [10] | |
| 7 | GDC-0425 | Drug Info | Phase 1 | Lymphoma | [11] | |
| 8 | MK-8776 | Drug Info | Phase 1 | Hodgkin lymphoma | [12] | |
| 9 | RG7741 | Drug Info | Phase 1 | Lymphoma | [13] | |
| Discontinued Drug(s) | [+] 3 Discontinued Drugs | + | ||||
| 1 | PF-477736 | Drug Info | Discontinued in Phase 1 | Advanced solid tumour | [14], [15] | |
| 2 | RG7602 | Drug Info | Discontinued in Phase 1 | Lymphoma | [16] | |
| 3 | XL844 | Drug Info | Discontinued in Phase 1 | Solid tumour/cancer | [17] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 5 Modulator drugs | + | ||||
| 1 | LY2603618 | Drug Info | [18] | |||
| 2 | GDC-0425 | Drug Info | [27] | |||
| 3 | RG7741 | Drug Info | [29], [30] | |||
| 4 | RG7602 | Drug Info | [33] | |||
| 5 | XL844 | Drug Info | [34] | |||
| Inhibitor | [+] 41 Inhibitor drugs | + | ||||
| 1 | LY2606368 | Drug Info | [4], [19] | |||
| 2 | SCH-900776 | Drug Info | [20] | |||
| 3 | UCN-01 | Drug Info | [1], [21], [22], [23], [24] | |||
| 4 | LY2880070 | Drug Info | [25] | |||
| 5 | AZD7762 | Drug Info | [26] | |||
| 6 | MK-8776 | Drug Info | [28] | |||
| 7 | Diamidothiazole derivative 1 | Drug Info | [31] | |||
| 8 | PF-477736 | Drug Info | [32] | |||
| 9 | 2-(1H-indazol-3-yl)-1H-benzo[d]imidazole | Drug Info | [35] | |||
| 10 | 2-(cyclohexylamino)benzoic acid | Drug Info | [35] | |||
| 11 | 3-(1H-Indol-2-yl)-1H-quinolin-2-one | Drug Info | [36] | |||
| 12 | 4,5,6,7-tetrabromo-1H-benzo[d][1,2,3]triazole | Drug Info | [37] | |||
| 13 | 4-[(3,5-diamino-1H-pyrazol-4-yl)diazenyl]phenol | Drug Info | [38] | |||
| 14 | 6-(3-aminopropyl)benzo[h]isoquinolin-1(2H)-one | Drug Info | [39] | |||
| 15 | 6-MORPHOLIN-4-YL-9H-PURINE | Drug Info | [35] | |||
| 16 | 9-chlorobenzo[h]isoquinolin-1(2H)-one | Drug Info | [39] | |||
| 17 | 9-hydroxypyrrolo[3,4-c]carbazole-1,3(2H,6H)-dione | Drug Info | [40] | |||
| 18 | A-432411 | Drug Info | [41] | |||
| 19 | ARRY-575 | Drug Info | [42] | |||
| 20 | BIS-IMIDE A | Drug Info | [43] | |||
| 21 | Bisindolylmaleimide-I | Drug Info | [44] | |||
| 22 | BX-795 | Drug Info | [45] | |||
| 23 | BX-912 | Drug Info | [45] | |||
| 24 | CCT244747 | Drug Info | [46] | |||
| 25 | Chk1-A | Drug Info | [42] | |||
| 26 | CI-1040 | Drug Info | [44] | |||
| 27 | DEBROMOHYMENIALDISINE | Drug Info | [47] | |||
| 28 | GRANULATIMIDE | Drug Info | [43] | |||
| 29 | Isogranulatimide | Drug Info | [43] | |||
| 30 | KN-62 | Drug Info | [44] | |||
| 31 | N-(5,6-DIPHENYLFURO[2,3-D]PYRIMIDIN-4-YL)GLYCINE | Drug Info | [35] | |||
| 32 | NU-6102 | Drug Info | [48] | |||
| 33 | PMID17935989C25 | Drug Info | [49] | |||
| 34 | PMID19364658C33 | Drug Info | [50] | |||
| 35 | PMID20855207C25 | Drug Info | [51] | |||
| 36 | RO-316233 | Drug Info | [44] | |||
| 37 | S-024 | Drug Info | [42] | |||
| 38 | S-070 | Drug Info | [42] | |||
| 39 | SB 218078 | Drug Info | [52] | |||
| 40 | SB218078 | Drug Info | [53] | |||
| 41 | V158411 | Drug Info | [54] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Drug Binding Sites of Target | Top | |||||
|---|---|---|---|---|---|---|
| Ligand Name: Adenine | Ligand Info | |||||
| Structure Description | Crystal structure of CHK1-10pt-mutant complex with adenine | PDB:7BJE | ||||
| Method | X-ray diffraction | Resolution | 1.80 Å | Mutation | Yes | [55] |
| PDB Sequence |
PFVEDWDLVQ
13 TLGEGAYGEV23 QLAVNRVTEE33 AVAVKIVDMN51 IKKEICILKM61 LNHENVIKFY 71 GHRREGNIQY81 LFMELASGGS91 LFDRIEPDIG101 MPEPDAQRFF111 HQLMAGVVYL 121 HGIGITHRDI131 KPHNLLLDER141 DNLKIADYSL151 ATVFRYNNRE161 RLLNKMCGTL 171 PYVAPELLKR181 REFHAEPVDV191 WSCGIVLTAM201 LAGELPWDQP211 SDSCQEYSDW 221 KEKKTYLNPW231 KKIDSAPLAL241 LHKILVENPS251 ARITIPDIKK261 DRWYNKPLK |
|||||
|
|
||||||
| Click to View More Binding Site Information of This Target and Ligand Pair | ||||||
| Ligand Name: UCN-01 | Ligand Info | |||||
| Structure Description | The Complex Structure Of Checkpoint Kinase Chk1/UCN-01 | PDB:1NVQ | ||||
| Method | X-ray diffraction | Resolution | 2.00 Å | Mutation | No | [56] |
| PDB Sequence |
VPFVEDWDLV
12 QTLGEGAYGE22 VQLAVNRVTE32 EAVAVKIVDM42 KNIKKEICIN59 KMLNHENVVK 69 FYGHRREGNI79 QYLFLEYCSG89 GELFDRIEPD99 IGMPEPDAQR109 FFHQLMAGVV 119 YLHGIGITHR129 DIKPENLLLD139 ERDNLKISDF149 GLATVFRYNN159 RERLLNKMCG 169 TLPYVAPELL179 KRREFHAEPV189 DVWSCGIVLT199 AMLAGELPWD209 QPSDSCQEYS 219 DWKEKKTYLN229 PWKKIDSAPL239 ALLHKILVEN249 PSARITIPDI259 KKDRWYNKPL 269 KKGA
|
|||||
|
|
||||||
| Click to View More Binding Site Information of This Target with Different Ligands | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Tissue Distribution
Human Pathway Affiliation
Biological Network Descriptors
|
|
|
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
| KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
|---|---|---|---|
| Cell cycle | hsa04110 | Affiliated Target |
|
| Class: Cellular Processes => Cell growth and death | Pathway Hierarchy | ||
| p53 signaling pathway | hsa04115 | Affiliated Target |
|
| Class: Cellular Processes => Cell growth and death | Pathway Hierarchy | ||
| Cellular senescence | hsa04218 | Affiliated Target |
|
| Class: Cellular Processes => Cell growth and death | Pathway Hierarchy | ||
| Degree | 63 | Degree centrality | 6.77E-03 | Betweenness centrality | 3.25E-03 |
|---|---|---|---|---|---|
| Closeness centrality | 2.53E-01 | Radiality | 1.44E+01 | Clustering coefficient | 2.33E-01 |
| Neighborhood connectivity | 4.41E+01 | Topological coefficient | 5.50E-02 | Eccentricity | 11 |
| Download | Click to Download the Full PPI Network of This Target | ||||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Characterization of an inhibitory dynamic pharmacophore for the ERCC1-XPA interaction using a combined molecular dynamics and virtual screening app... J Mol Graph Model. 2009 Sep;28(2):113-30. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7960). | |||||
| REF 3 | ClinicalTrials.gov (NCT00988858) A Study of Advanced or Metastatic Non-small Cell Lung Cancer. U.S. National Institutes of Health. | |||||
| REF 4 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7943). | |||||
| REF 6 | ClinicalTrials.gov (NCT01870596) Cytarabine With or Without SCH 900776 in Treating Adult Patients With Relapsed Acute Myeloid Leukemia. U.S. National Institutes of Health. | |||||
| REF 7 | ClinicalTrials.gov (NCT00082017) UCN-01 (7-Hydroxystaurosporine) to Treat Relapsed T-Cell Lymphomas. U.S. National Institutes of Health. | |||||
| REF 8 | ClinicalTrials.gov (NCT02632448) A Study of LY2880070 in Participants With Advanced or Metastatic Cancer. U.S. National Institutes of Health. | |||||
| REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7713). | |||||
| REF 10 | ClinicalTrials.gov (NCT00473616) Phase I Single Ascending Dose/Multiple Ascending Dose in Patients Treated With AZD7762 and Irinotecan. U.S. National Institutes of Health. | |||||
| REF 11 | ClinicalTrials.gov (NCT01359696) A Study Evaluating the Safety, Tolerability, and Pharmacokinetics of GDC-0425 Administered With and Without Gemcitabine in Patients With Refractory Solid Tumors or Lymphoma. U.S. National Institutes of Health. | |||||
| REF 12 | ClinicalTrials.gov (NCT00779584) A Dose-escalation Study of MK-8776 (SCH 900776) With and Without Gemcitabine in Participants With Solid Tumors or Lymphoma (MK-8776-002/P05248). U.S. National Institutes of Health. | |||||
| REF 13 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034037) | |||||
| REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8043). | |||||
| REF 15 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022394) | |||||
| REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034639) | |||||
| REF 17 | ClinicalTrials.gov (NCT00234481) Safety Study of XL844 in Subjects With Chronic Lymphocytic Leukemia. U.S. National Institutes of Health. | |||||
| REF 18 | Characterization and preclinical development of LY2603618: a selective and potent Chk1 inhibitor. Invest New Drugs. 2014 Apr;32(2):213-26. | |||||
| REF 19 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 20 | Targeting the replication checkpoint using SCH 900776, a potent and functionally selective CHK1 inhibitor identified via high content screening. Mol Cancer Ther. 2011 Apr;10(4):591-602. | |||||
| REF 21 | CHK1 inhibition as a strategy for targeting Fanconi Anemia (FA) DNA repair pathway deficient tumors. Mol Cancer. 2009 Apr 16;8:24. | |||||
| REF 22 | UCN-01 inhibits p53 up-regulation and abrogates gamma-radiation-induced G(2)-M checkpoint independently of p53 by targeting both of the checkpoint kinases, Chk2 and Chk1. Cancer Res. 2002 Oct 15;62(20):5743-8. | |||||
| REF 23 | The PI3K/Akt pathway as a target in the treatment of hematologic malignancies. Anticancer Agents Med Chem. 2009 Jun;9(5):550-9. | |||||
| REF 24 | Cyclin-dependent kinase inhibitors as potential targeted anticancer agents. Invest New Drugs. 2009 Dec;27(6):586-94. | |||||
| REF 25 | A phase Ib study of oral Chk1 inhibitor LY2880070 in combination with gemcitabine in patients with advanced or metastatic cancer. Journal of Clinical Oncology 38, no. 15_suppl (May 20, 2020) 3581-3581. | |||||
| REF 26 | Clinical pipeline report, company report or official report of AstraZeneca (2009). | |||||
| REF 27 | Quantitative assessment of BCL-2:BIM complexes as a pharmacodynamic marker for venetoclax (ABT-199). | |||||
| REF 28 | Chk1 Inhibitor MK-8776 Restores the Sensitivity of Chemotherapeutics in P-glycoprotein Overexpressing Cancer Cells. Int J Mol Sci. 2019 Aug 22;20(17):4095. | |||||
| REF 29 | National Cancer Institute Drug Dictionary (drug id 730054). | |||||
| REF 30 | Structure-based design, discovery and development of checkpoint kinase inhibitors as potential anti-cancer therapies. Expert Opin Drug Discov. 2013 June; 8(6): 621-640. | |||||
| REF 31 | Cyclin-dependent kinase inhibitors for cancer therapy: a patent review (2009 - 2014).Expert Opin Ther Pat. 2015;25(9):953-70. | |||||
| REF 32 | Cell cycle kinases as therapeutic targets for cancer. Nat Rev Drug Discov. 2009 Jul;8(7):547-66. | |||||
| REF 33 | National Cancer Institute Drug Dictionary (drug id 701310). | |||||
| REF 34 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
| REF 35 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
| REF 36 | Development of 6-substituted indolylquinolinones as potent Chek1 kinase inhibitors. Bioorg Med Chem Lett. 2006 Nov 15;16(22):5907-12. | |||||
| REF 37 | Optimization of protein kinase CK2 inhibitors derived from 4,5,6,7-tetrabromobenzimidazole. J Med Chem. 2004 Dec 2;47(25):6239-47. | |||||
| REF 38 | 4-arylazo-3,5-diamino-1H-pyrazole CDK inhibitors: SAR study, crystal structure in complex with CDK2, selectivity, and cellular effects. J Med Chem. 2006 Nov 2;49(22):6500-9. | |||||
| REF 39 | Synthesis and evaluation of substituted benzoisoquinolinones as potent inhibitors of Chk1 kinase. Bioorg Med Chem Lett. 2007 Nov 15;17(22):6280-5. | |||||
| REF 40 | 4-Phenylpyrrolo[3,4-c]carbazole-1,3(2H,6H)-dione inhibitors of the checkpoint kinase Wee1. Structure-activity relationships for chromophore modific... J Med Chem. 2006 Aug 10;49(16):4896-911. | |||||
| REF 41 | Synthesis of selenophene derivatives as novel CHK1 inhibitors. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5065-8. | |||||
| REF 42 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1987). | |||||
| REF 43 | Synthesis, in vitro antiproliferative activities, and Chk1 inhibitory properties of pyrrolo[3,4-a]carbazole-1,3-diones, pyrrolo[3,4-c]carbazole-1,3... Eur J Med Chem. 2008 Feb;43(2):282-92. | |||||
| REF 44 | Specificity and mechanism of action of some commonly used protein kinase inhibitors. Biochem J. 2000 Oct 1;351(Pt 1):95-105. | |||||
| REF 45 | Novel small molecule inhibitors of 3-phosphoinositide-dependent kinase-1. J Biol Chem. 2005 May 20;280(20):19867-74. | |||||
| REF 46 | Discovery of 3-alkoxyamino-5-(pyridin-2-ylamino)pyrazine-2-carbonitriles as selective, orally bioavailable CHK1 inhibitors. J Med Chem. 2012 Nov 26;55(22):10229-40. | |||||
| REF 47 | Potent inhibition of checkpoint kinase activity by a hymenialdisine-derived indoloazepine. Bioorg Med Chem Lett. 2004 Aug 16;14(16):4319-21. | |||||
| REF 48 | Triazolo[1,5-a]pyrimidines as novel CDK2 inhibitors: protein structure-guided design and SAR. Bioorg Med Chem Lett. 2006 Mar 1;16(5):1353-7. | |||||
| REF 49 | Macrocyclic ureas as potent and selective Chk1 inhibitors: an improved synthesis, kinome profiling, structure-activity relationships, and prelimina... Bioorg Med Chem Lett. 2007 Dec 1;17(23):6593-601. | |||||
| REF 50 | Identification and SAR of squarate inhibitors of mitogen activated protein kinase-activated protein kinase 2 (MK-2). Bioorg Med Chem. 2009 May 1;17(9):3342-51. | |||||
| REF 51 | Discovery of orally bioavailable imidazo[1,2-a]pyrazine-based Aurora kinase inhibitors. Bioorg Med Chem Lett. 2010 Nov 15;20(22):6739-43. | |||||
| REF 52 | An indolocarbazole inhibitor of human checkpoint kinase (Chk1) abrogates cell cycle arrest caused by DNA damage. Cancer Res. 2000 Feb 1;60(3):566-72. | |||||
| REF 53 | Chk1 inhibitor synergizes quinacrine mediated apoptosis in breast cancer cells by compromising the base excision repair cascade. Biochem Pharmacol. 2016 Apr 1;105:23-33. | |||||
| REF 54 | Cell Density Affects the Detection of Chk1 Target Engagement by the Selective Inhibitor V158411. SLAS Discov. 2018 Feb;23(2):144-153. | |||||
| REF 55 | Design and Synthesis of Pyrrolo[2,3-d]pyrimidine-Derived Leucine-Rich Repeat Kinase 2 (LRRK2) Inhibitors Using a Checkpoint Kinase 1 (CHK1)-Derived Crystallographic Surrogate. J Med Chem. 2021 Jul 22;64(14):10312-10332. | |||||
| REF 56 | Structural basis for Chk1 inhibition by UCN-01. J Biol Chem. 2002 Nov 29;277(48):46609-15. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.