Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T03346
|
||||
| Former ID |
TTDC00081
|
||||
| Target Name |
Interleukin-4 receptor alpha chain
|
||||
| Gene Name |
IL4R
|
||||
| Synonyms |
CD124 antigen; IL-4R; IL-4R-alpha; IL4R
|
||||
| Target Type |
Successful
|
||||
| Disease | Asthma [ICD10: J45] | ||||
| Asthma; Atopic dermatitis [ICD9: 493, 691.8, 692.9; ICD10: J45, L20-L30] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Moderate-to-severe atopic dermatitis [ICD10: L20] | |||||
| Pulmonary fibrosis [ICD9: 515, 516.3; ICD10: J84.1] | |||||
| Function |
This is a receptor for interleukin 4. A soluble form of the il4 receptor may represent a regulatory molecule specific for il4-dependent immune responses.
|
||||
| BioChemical Class |
Cytokine receptor
|
||||
| Target Validation |
T03346
|
||||
| UniProt ID | |||||
| Sequence |
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRL
LYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEH VKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYL EPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSVS CIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQDAQGSQWEKRSRGQEPAKCP HWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVR CVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGEENG GFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPD NLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPT TVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGE AGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPGCPGDPAPVPVPLFTFGLDRE PPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVDSLGSGIVYSALTCHL CGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLEASLCPASL APSGISEKSKSSSSFHPAPGNAQSSSQTPKIVNFVSVGPTYMRVS |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Dupilumab | Drug Info | Approved | Moderate-to-severe atopic dermatitis | [1] |
| Dupilumab | Drug Info | Phase 3 | Asthma | [2], [3] | |
| SAR231893 | Drug Info | Phase 3 | Asthma; Atopic dermatitis | [4] | |
| Aerovant | Drug Info | Phase 2a | Asthma | [5] | |
| Altrakincept | Drug Info | Phase 2 | Asthma | [6] | |
| PRX-321 | Drug Info | Phase 2 | Cancer | [7] | |
| SAR-156597 | Drug Info | Phase 2 | Pulmonary fibrosis | [8] | |
| AMG 317 | Drug Info | Discontinued in Phase 1 | Asthma | [9] | |
| Antagonist | Aerovant | Drug Info | [10] | ||
| AMG 317 | Drug Info | [11], [12] | |||
| APG-201 | Drug Info | [13] | |||
| Modulator | Altrakincept | Drug Info | [14] | ||
| SAR231893 | Drug Info | [15], [16] | |||
| Inhibitor | PRS-060 | Drug Info | [13] | ||
| Agonist | PRX-321 | Drug Info | [17] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| PI3K-Akt signaling pathway | |||||
| Jak-STAT signaling pathway | |||||
| Hematopoietic cell lineage | |||||
| Inflammatory bowel disease (IBD) | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| IL4 Signaling Pathway | |||||
| EGFR1 Signaling Pathway | |||||
| PANTHER Pathway | Interleukin signaling pathway | ||||
| Pathway Interaction Database | p73 transcription factor network | ||||
| IL4-mediated signaling events | |||||
| WikiPathways | Inflammatory Response Pathway | ||||
| IL-4 Signaling Pathway | |||||
| References | |||||
| REF 1 | Drugs@FDA (Edaravone) | ||||
| REF 2 | ClinicalTrials.gov (NCT01949311) Open-label Study of Dupilumab (REGN668/SAR231893) in Patients With Atopic Dermatitis. U.S. National Institutes of Health. | ||||
| REF 3 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7574). | ||||
| REF 4 | ClinicalTrials.gov (NCT02134028) Long-Term Safety Evaluation of Dupilumab in Patients With Asthma. U.S. National Institutes of Health. | ||||
| REF 5 | Emerging drugs for asthma. Expert Opin Emerg Drugs. 2008 Dec;13(4):643-53. | ||||
| REF 6 | Interleukin-4 receptor in moderate atopic asthma. A phase I/II randomized, placebo-controlled trial. Am J Respir Crit Care Med. 1999 Dec;160(6):1816-23. | ||||
| REF 7 | ClinicalTrials.gov (NCT00797940) Convection Enhanced Localized Administration of PRX321 With Real-time Imaging for Therapy of Recurrent Glioblastoma (CLARITY-1). U.S. National Institutes of Health. | ||||
| REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034106) | ||||
| REF 9 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017312) | ||||
| REF 10 | Aerovance starts trial of Aerovant for uncontrolled asthma. Aerovance. March 3, 2009. | ||||
| REF 11 | Clinical pipeline report, company report or official report of Amgen (2009). | ||||
| REF 12 | Randomized, double-blind, placebo-controlled trial of the oral interleukin-12/23 inhibitor apilimod mesylate for treatment of active Crohn's disease. Inflamm Bowel Dis. 2010 Jul;16(7):1209-18. | ||||
| REF 13 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1697). | ||||
| REF 14 | The potential of biologics for the treatment of asthma. Nat Rev Drug Discov. 2012 Dec;11(12):958-72. doi: 10.1038/nrd3792. | ||||
| REF 15 | ClinicalTrials.gov (NCT02277769) Study of Dupilumab (REGN668/SAR231893) Monotherapy Administered to Adult Patients With Moderate-to-Severe Atopic Dermatitis. U.S. National Institutes of Health. | ||||
| REF 16 | Dupilumab in persistent asthma with elevated eosinophil levels. N Engl J Med. 2013 Jun 27;368(26):2455-66. | ||||
| REF 17 | Convection-enhanced drug delivery of interleukin-4 pseudomonas exotoxin (PRX321): increased distribution and magnetic resonance monitoring. J Pharmacol Exp Ther. 2009 Aug;330(2):520-5. Epub 2009 May28. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.