Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T03346
|
||||
Former ID |
TTDC00081
|
||||
Target Name |
Interleukin-4 receptor alpha chain
|
||||
Gene Name |
IL4R
|
||||
Synonyms |
CD124 antigen; IL-4R; IL-4R-alpha; IL4R
|
||||
Target Type |
Successful
|
||||
Disease | Asthma [ICD10: J45] | ||||
Asthma; Atopic dermatitis [ICD9: 493, 691.8, 692.9; ICD10: J45, L20-L30] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Moderate-to-severe atopic dermatitis [ICD10: L20] | |||||
Pulmonary fibrosis [ICD9: 515, 516.3; ICD10: J84.1] | |||||
Function |
This is a receptor for interleukin 4. A soluble form of the il4 receptor may represent a regulatory molecule specific for il4-dependent immune responses.
|
||||
BioChemical Class |
Cytokine receptor
|
||||
Target Validation |
T03346
|
||||
UniProt ID | |||||
Sequence |
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRL
LYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEH VKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYL EPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSVS CIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQDAQGSQWEKRSRGQEPAKCP HWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVR CVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGEENG GFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPD NLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPT TVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGE AGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPGCPGDPAPVPVPLFTFGLDRE PPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVDSLGSGIVYSALTCHL CGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLEASLCPASL APSGISEKSKSSSSFHPAPGNAQSSSQTPKIVNFVSVGPTYMRVS |
||||
Drugs and Mode of Action | |||||
Drug(s) | Dupilumab | Drug Info | Approved | Moderate-to-severe atopic dermatitis | [889446] |
Dupilumab | Drug Info | Phase 3 | Asthma | [524442], [542567] | |
SAR231893 | Drug Info | Phase 3 | Asthma; Atopic dermatitis | [524747] | |
Aerovant | Drug Info | Phase 2a | Asthma | [536958] | |
Altrakincept | Drug Info | Phase 2 | Asthma | [889438] | |
PRX-321 | Drug Info | Phase 2 | Cancer | [522499] | |
SAR-156597 | Drug Info | Phase 2 | Pulmonary fibrosis | [549242] | |
AMG 317 | Drug Info | Discontinued in Phase 1 | Asthma | [547559] | |
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
PI3K-Akt signaling pathway | |||||
Jak-STAT signaling pathway | |||||
Hematopoietic cell lineage | |||||
Inflammatory bowel disease (IBD) | |||||
NetPath Pathway | IL2 Signaling Pathway | ||||
IL4 Signaling Pathway | |||||
EGFR1 Signaling Pathway | |||||
PANTHER Pathway | Interleukin signaling pathway | ||||
Pathway Interaction Database | p73 transcription factor network | ||||
IL4-mediated signaling events | |||||
WikiPathways | Inflammatory Response Pathway | ||||
IL-4 Signaling Pathway | |||||
References | |||||
Ref 522499 | ClinicalTrials.gov (NCT00797940) Convection Enhanced Localized Administration of PRX321 With Real-time Imaging for Therapy of Recurrent Glioblastoma (CLARITY-1). U.S. National Institutes of Health. | ||||
Ref 524442 | ClinicalTrials.gov (NCT01949311) Open-label Study of Dupilumab (REGN668/SAR231893) in Patients With Atopic Dermatitis. U.S. National Institutes of Health. | ||||
Ref 524747 | ClinicalTrials.gov (NCT02134028) Long-Term Safety Evaluation of Dupilumab in Patients With Asthma. U.S. National Institutes of Health. | ||||
Ref 542567 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7574). | ||||
Ref 547559 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017312) | ||||
Ref 549242 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034106) | ||||
Ref 524972 | ClinicalTrials.gov (NCT02277769) Study of Dupilumab (REGN668/SAR231893) Monotherapy Administered to Adult Patients With Moderate-to-Severe Atopic Dermatitis. U.S. National Institutes of Health. | ||||
Ref 532365 | Dupilumab in persistent asthma with elevated eosinophil levels. N Engl J Med. 2013 Jun 27;368(26):2455-66. | ||||
Ref 537389 | Convection-enhanced drug delivery of interleukin-4 pseudomonas exotoxin (PRX321): increased distribution and magnetic resonance monitoring. J Pharmacol Exp Ther. 2009 Aug;330(2):520-5. Epub 2009 May28. | ||||
Ref 543460 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1697). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.