Target Information

Target General Infomation
Target ID
T07958
Former ID
TTDI01917
Target Name
Erythropoietin ligand
Gene Name
EPO
Synonyms
Epoetin; Erythropoietin; EPO
Target Type
Clinical Trial
Disease Anemia [ICD9: 280-285; ICD10: D50-D64]
Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63]
Depression; Diabetic neuropathy; Mood disorder [ICD9:311, 250, 250.6, 356.0, 356.8; ICD10: F30-F39, E11.40]
Unspecified [ICD code not available]
Function
Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
UniProt ID
P01588
Sequence
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC
SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL
KLYTGEACRTGDR
Drugs and Mode of Action
Drug(s) ARA 290 Drug Info Phase 2 Depression; Diabetic neuropathy; Mood disorder [549308]
MK-2578 Drug Info Phase 2 Anemia [522772]
Erythropoietin-transfected autologous cell therapy Drug Info Phase 1/2 Anemia [522139]
GC-1113 Drug Info Phase 1 Anemia [523499]
Long-acting erythropoietin conjugate Drug Info Phase 1 Anemia [522889]
FC EPO Drug Info Discontinued in Phase 1 Anemia [548647]
GLY-515n Drug Info Terminated Cerebrovascular ischaemia [548665]
Modulator ARA 290 Drug Info
Erythropoietin-transfected autologous cell therapy Drug Info [525362]
GC-1113 Drug Info [531927]
GLY-515n Drug Info [548666]
Long-acting erythropoietin conjugate Drug Info
Research programme: erythropoietin oral - HanAll Biopharma Drug Info
Agonist FC EPO Drug Info [531957]
MK-2578 Drug Info [525376]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Pathway Interaction Database HIF-2-alpha transcription factor network
Signaling events mediated by Stem cell factor receptor (c-Kit)
EPO signaling pathway
HIF-1-alpha transcription factor network
Reactome Regulation of gene expression by Hypoxia-inducible Factor
WikiPathways EPO Receptor Signaling
Hematopoietic Stem Cell Differentiation
Differentiation Pathway
Regulation of Hypoxia-inducible Factor (HIF) by Oxygen
References
Ref 522139ClinicalTrials.gov (NCT00542568) Safety and Efficacy of Sustained Erythropoietin Therapy. U.S. National Institutes of Health.
Ref 522772ClinicalTrials.gov (NCT00968617) A Study of MK2578 in Patients With Chronic Kidney Disease Who Are Not on Dialysis (2578-002). U.S. National Institutes of Health.
Ref 522889ClinicalTrials.gov (NCT01030315) A Study of HM10760A (Long-acting Erythropoietin) in Healthy Adult Caucasian and Japanese Subjects. U.S. National Institutes of Health.
Ref 523499ClinicalTrials.gov (NCT01363934) To Evaluate the Safety, Tolerability, and Pharmacokinetics/Pharmacodynamics of Erythropoietin. U.S. National Institutes of Health.
Ref 548647Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027346)
Ref 548665Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027536)
Ref 549308Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035038)
Ref 525362Mesenchymal stromal cells engineered to express erythropoietin induce anti-erythropoietin antibodies and anemia in allorecipients. Mol Ther. 2009 Feb;17(2):369-72. doi: 10.1038/mt.2008.270. Epub 2008 Dec 16.
Ref 525376Merck ditches biogeneric. Nat Biotechnol. 2010 Jul;28(7):636. doi: 10.1038/nbt0710-636a.
Ref 531927A long-acting erythropoietin fused with noncytolytic human Fc for the treatment of anemia. Arch Pharm Res. 2012 May;35(5):757-9.
Ref 531957Detection of EPO-Fc fusion protein in human blood: screening and confirmation protocols for sports drug testing. Drug Test Anal. 2012 Nov;4(11):818-29.
Ref 548666Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027536)

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.