Target General Infomation
Target ID
T22118
Former ID
TTDS00011
Target Name
Dopamine D1 receptor
Gene Name
DRD1
Synonyms
D(1) dopamine receptor; D(1A) dopamine receptor; DRD1
Target Type
Successful
Disease Allergy [ICD9: 995.3; ICD10: T78.4]
Cocaine addiction [ICD9: 304.2; ICD10: F14.2]
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3]
Dementia [ICD9: 290-294; ICD10: F01-F07]
Excessive bleeding following childbirth and spontaneous or elective abortion [ICD10: O04]
Glaucoma [ICD9: 365; ICD10: H40-H42]
Hypertension [ICD9: 401; ICD10: I10-I16]
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89]
Psychotic disorders [ICD9: 290-299; ICD10: F20-F29]
Psychiatric disorder [ICD9: 290-319; ICD10: F01-F99]
Parkinson's disease [ICD9: 332; ICD10: G20]
Schizophrenia [ICD9: 295; ICD10: F20]
Sexual dysfunction [ICD9: 302.7; ICD10: F52]
Substance dependence [ICD10: F10-F19]
Type 2 diabetes [ICD9: 250; ICD10: E11]
Unspecified [ICD code not available]
Function
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
BioChemical Class
GPCR rhodopsin
Target Validation
T22118
UniProt ID
Sequence
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Drugs and Mode of Action
Drug(s) Fenoldopam Drug Info Approved Hypertension [1], [2]
Methylergonovine Drug Info Approved Excessive bleeding following childbirth and spontaneous or elective abortion [3]
Pergolide Drug Info Approved Parkinson's disease [4], [5]
Phenyltoloxamine Drug Info Approved Allergy [3]
Ecopipam Drug Info Phase 3 Cocaine addiction [6], [7]
Zicronapine Drug Info Phase 3 Schizophrenia [8]
DAS-431 IV Drug Info Phase 2 Dementia [9]
Intranasal apomorphine Drug Info Phase 2 Sexual dysfunction [10]
Dihydrexidine Drug Info Phase 1/2 Psychotic disorders [11]
BSF-78438 Drug Info Preclinical Schizophrenia [12]
D1 agonist D2 antagonist Drug Info Preclinical Schizophrenia [12]
ADROGOLIDE HYDROCHLORIDE Drug Info Discontinued in Phase 2 Cognitive disorders [13]
ADX-10061 Drug Info Discontinued in Phase 2 Psychotic disorders [14]
BAM-1110 Drug Info Discontinued in Phase 2 Parkinson's disease [15]
CY-208243 Drug Info Discontinued in Phase 2 Pain [16]
ZELANDOPAM HYDROCHLORIDE Drug Info Discontinued in Phase 2 Hypertension [17]
Berupipam Drug Info Discontinued in Phase 1 Psychotic disorders [18]
BTS-73947 Drug Info Discontinued in Phase 1 Psychotic disorders [19]
Odapipam Drug Info Discontinued in Phase 1 Psychotic disorders [20]
SDZ-GLC-756 Drug Info Discontinued in Phase 1 Glaucoma [21]
A 77636 Drug Info Terminated Parkinson's disease [22]
A-68930 Drug Info Terminated Hypertension [23], [24]
A-69024 Drug Info Terminated Psychotic disorders [25]
BIMG80 Drug Info Terminated Psychotic disorders [26]
CEE-03-320 Drug Info Terminated Substance dependence [27]
NNC-22-0031 Drug Info Terminated Psychotic disorders [28]
Org-10490 Drug Info Terminated Psychotic disorders [29]
SDZ-PSD-958 Drug Info Terminated Psychiatric disorder [30]
SKF 38393 Drug Info Terminated Type 2 diabetes [31], [32]
SKF-81297 Drug Info Terminated Parkinson's disease [33], [34]
Inhibitor (+)-(1R,1'S)-berbamunine hydrochloride Drug Info [35]
(+)-(1R,1'S)-thaligrisine hydrochloride Drug Info [35]
(+)-BUTACLAMOL Drug Info [36]
(+/-)-nantenine Drug Info [37]
(-)-(1S,1'R)-O,O-dimethylgrisbine hydrochloride Drug Info [35]
(R)-(+)-coclaurine Drug Info [38]
(R)-(-)-10-methyl-11-hydroxyaporphine Drug Info [39]
(R)-(-)-11-hydroxy-N-n-propylnoraporphine Drug Info [40]
(R)-(-)-2-methoxy-11-hydroxyaporphine Drug Info [40]
(R)-(-)-2-methoxy-N-npropylnorapomorphine Drug Info [40]
(R)-(-)-N-ethyl-2-methoxy-11-hydroxynoraporphine Drug Info [40]
(R)-(-)-N-propyl-2-methoxy-11-hydroxynoraporphine Drug Info [40]
(R)-11-Amino-2-methoxyaporphine Drug Info [41]
(R)-2,11-Diaminoaporphine Drug Info [41]
(R,S)-homoaromaline hydrochloride Drug Info [35]
(S)-BULBOCAPNINE Drug Info [42]
(S)APOMORPHINE Drug Info [43]
(S,S)-oxandrine hydrochloride Drug Info [35]
1,2,3,7,12,12a-hexahydro-1-aza-pleiaden-5-ol Drug Info [42]
1,2,3,7,12,12a-hexahydro-1-aza-pleiadene-5,6-diol Drug Info [42]
1,2-Bis-[R-(-)-apomorphine-2'-oxy]ethane Drug Info [44]
1-(4-(1H-pyrazol-1-yl)benzyl)-4-phenylpiperazine Drug Info [45]
1-Aminomethyl-3-cyclohexyl-isochroman-5,6-diol Drug Info [46]
1-Aminomethyl-3-phenyl-isochroman-5,6-diol Drug Info [47]
1-Aminomethyl-isochroman-5,6-diol Drug Info [47]
1-Benzyl-4-(2-ethynyl-pyrrol-1-yl)-piperidine Drug Info [48]
1-Benzyl-4-(2-iodo-pyrrol-1-yl)-piperidine Drug Info [48]
1-Benzyl-4-(2-oxazol-5-yl-pyrrol-1-yl)-piperidine Drug Info [48]
1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine Drug Info [49]
1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine Drug Info [50]
1-[2-(2-Benzyl-phenoxy)-ethyl]-pyrrolidine Drug Info [50]
1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine Drug Info [50]
11-Butyryloxy-N-n-propylnoraporphine Drug Info [51]
11-Heptanoyloxy-N-n-propylnoraporphine Drug Info [51]
11-Hexanoyloxy-N-n-propylnoraporphine Drug Info [51]
11-Propionyloxy-N-n-propylnoraporphine Drug Info [51]
11-valeryloxynoraporphine Drug Info [51]
2-methoxyapomorphine Drug Info [44]
2-Methyl-8-phenyl-1,2,3,4-tetrahydro-isoquinoline Drug Info [52]
2-{[R-(-)-Apomorphine-2'-oxy]ethoxy}-ethanol Drug Info [44]
3,8-dibromoboldine Drug Info [53]
3-bromoboldine Drug Info [53]
3-Chloroboldine Drug Info [53]
3-Iodoboldine Drug Info [53]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one Drug Info [54]
4-[2-(2-Benzyl-phenoxy)-ethyl]-morpholine Drug Info [50]
5-(2-Amino-ethyl)-2-chloro-phenol hydrobromide Drug Info [55]
6-(2-Amino-ethyl)-biphenyl-2,3,4'-triol Drug Info [56]
6-(2-Amino-ethyl)-biphenyl-2,3-diol Drug Info [56]
6-(2-Dipropylamino-ethyl)-biphenyl-2,3,4'-triol Drug Info [56]
6-(2-Dipropylamino-ethyl)-biphenyl-2,3-diol Drug Info [56]
9-Aminomethyl-9H-fluorene-2,5,6-triol Drug Info [56]
9-Aminomethyl-9H-fluorene-3,4-diol Drug Info [56]
A-70108 Drug Info [47]
BOLDINE Drug Info [53]
Dihydrexidine Drug Info [57]
Etoloxamine Drug Info [50]
FALCARINDIOL Drug Info [58]
FLUMEZAPINE Drug Info [59]
FLUTROLINE Drug Info [60]
GLAUCINE Drug Info [42]
IBZM Drug Info [61]
ISOCLOZAPINE Drug Info [62]
ISOLOXAPINE Drug Info [63]
MCL-516 Drug Info [64]
MELOSMINE Drug Info [42]
N-(4-Dipropylaminobutyl)-4-biphenylcarboxamide Drug Info [65]
N-(4-Propylaminobutyl)-4-biphenylcarboxamide Drug Info [65]
NORSTEPHALAGINE Drug Info [42]
Phenyltoloxamine Drug Info [50]
PUKATEINE Drug Info [42]
QUINPIROLE Drug Info [66]
R-N-PROPYLNORAPOMORPHINE Drug Info [40]
Ro-21-7767 Drug Info [67]
SB-271046 Drug Info [68]
SCH-12679 Drug Info [69]
SCH-24518 Drug Info [70]
SK&F-89626 Drug Info [71]
STEPHOLIDINE Drug Info [72]
TEPA (possesses cytotoxic activity) Drug Info [73]
[R-(-)-Apomorphine-2-yl]-(2'-hydroxy-ethyl)ether Drug Info [44]
Agonist (+)-ADTN Drug Info [74]
ADROGOLIDE HYDROCHLORIDE Drug Info [75], [3]
CY-208243 Drug Info [76]
D1 agonist D2 antagonist Drug Info [12]
DAS-431 IV Drug Info [75]
Fenoldopam Drug Info [77]
Intranasal apomorphine Drug Info [78]
N-propylnorapomorphine Drug Info [74]
SKF-75670 Drug Info [79]
SKF-83959 Drug Info [80]
Modulator A 77636 Drug Info
A-68930 Drug Info [81]
A-69024 Drug Info [82]
BAM-1110 Drug Info
BIMG80 Drug Info [83]
CEE-03-320 Drug Info [84]
Ecopipam Drug Info
ecopipam (controlled-release, Lesch Nyhan syndrome/Tourette's syndrome/compulsive gambling). Psyadon Pharmaceuticals Drug Info
NNC-22-0031 Drug Info [28]
Org-10490 Drug Info [85]
Pergolide Drug Info [85]
SDZ-GLC-756 Drug Info [86]
SDZ-PSD-958 Drug Info [87]
SKF 38393 Drug Info [31]
SKF-81297 Drug Info [88]
Zicronapine Drug Info [89]
Antagonist ADX-10061 Drug Info [90]
Berupipam Drug Info [91]
BTS-73947 Drug Info [92], [3]
Methylergonovine Drug Info [93]
Odapipam Drug Info [94]
SCH-23390 Drug Info [95]
SKF-83556 Drug Info [74]
ZELANDOPAM HYDROCHLORIDE Drug Info [96], [3]
[125I]SCH23982 Drug Info [97]
[3H]SCH-23390 Drug Info [98]
Binder BSF-78438 Drug Info [12]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Dopaminergic synapse
Parkinson&#039
s disease
Cocaine addiction
Amphetamine addiction
Morphine addiction
Alcoholism
PANTHER Pathway Dopamine receptor mediated signaling pathway
PathWhiz Pathway Dopamine Activation of Neurological Reward System
Reactome Dopamine receptors
G alpha (s) signalling events
WikiPathways Hypothetical Network for Drug Addiction
Monoamine GPCRs
GPCRs, Class A Rhodopsin-like
Genes and (Common) Pathways Underlying Drug Addiction
GPCR ligand binding
GPCR downstream signaling
References
REF 1Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
REF 2(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 985).
REF 3Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
REF 4(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 48).
REF 5Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54.
REF 6ClinicalTrials.gov (NCT01751802) Ecopipam Treatment of Self-Injurious Behavior in Subjects With Lesch-Nyhan Disease. U.S. National Institutes of Health.
REF 7(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3304).
REF 8ClinicalTrials.gov (NCT01295372) Safety and Efficacy of Zicronapine in Patients With Schizophrenia. U.S. National Institutes of Health.
REF 9The SAGE Handbook of Healthcare, Decision Resources Inc. Page(548).
REF 10Intranasal apomorphine. Nastech Pharmaceutical. IDrugs. 2004 May;7(5):483-8.
REF 11Effects of the D1 dopamine receptor agonist dihydrexidine (DAR-0100A) on working memory in schizotypal personality disorder. Neuropsychopharmacology. 2015 Jan;40(2):446-53.
REF 12The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31.
REF 13Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006590)
REF 14Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001476)
REF 15Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005232)
REF 16Decrease of behavioral and biochemical denervation supersensitivity of rat striatum by nigral transplants. Neuroscience. 1991;44(1):75-83.
REF 17Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002584)
REF 18Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004006)
REF 19Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008043)
REF 20Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006052)
REF 21Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008736)
REF 22Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002413)
REF 23(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6077).
REF 24Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002423)
REF 25Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002637)
REF 26Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006596)
REF 27Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007189)
REF 28NNC-19-1228 and NNC 22-0031, novel neuroleptics with a "mesolimbic-selective" behavioral profile. Psychopharmacology (Berl). 1997 Jan;129(2):168-78.
REF 29ORG 10490: A new antipsychotic drug with 5-HT2 and DA antagonistic properties. ScienceDirect, Volume 6, Issue 2, January 1992, Pages 111.
REF 30Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009027)
REF 31The D1 dopamine receptor agonist SKF-38393 stimulates the release of glutamate in the hippocampus. Neuroscience. 1999;94(4):1063-70.
REF 32(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 935).
REF 33(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 938).
REF 34Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004119)
REF 35Displacement activity of bisbenzylisoquinoline alkaloids at striatal 3H-SCH 23390 and 3H-raclopride binding sites. J Nat Prod. 1992 Sep;55(9):1281-6.
REF 36J Med Chem. 2000 May 18;43(10):2079-81.7-Methyl-6,7,8,9,14,15-hexahydro-5H-benz[d]indolo[2,3-g]azecine: a new heterocyclic system and a new lead compound for dopamine receptor antagonists.
REF 37Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine.
REF 38J Nat Prod. 1998 Jun 26;61(6):709-12.Synthesis and dopamine receptor selectivity of the benzyltetrahydroisoquinoline, (R)-(+)-nor-roefractine.
REF 39Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30. Epub 2007 May 23.R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands.
REF 40J Med Chem. 2008 Feb 28;51(4):983-7. Epub 2008 Feb 6.Synthesis and dopamine receptor affinities of N-alkyl-11-hydroxy-2-methoxynoraporphines: N-alkyl substituents determine D1 versus D2 receptor selectivity.
REF 41Bioorg Med Chem. 2008 Jul 15;16(14):6675-81. Epub 2008 Jun 5.Synthesis and pharmacological investigation of novel 2-aminothiazole-privileged aporphines.
REF 42J Med Chem. 2007 Jan 25;50(2):171-81.Advances in development of dopaminergic aporphinoids.
REF 43J Med Chem. 1990 Jun;33(6):1800-5.Synthesis and dopamine receptor affinities of enantiomers of 2-substituted apomorphines and their N-n-propyl analogues.
REF 44Bioorg Med Chem. 2008 Apr 15;16(8):4563-8. Epub 2008 Feb 15.Synthesis and neuropharmacological characterization of 2-O-substituted apomorphines.
REF 45Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9. Epub 2006 Mar 24.Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype.
REF 46J Med Chem. 1991 Oct;34(10):2946-53.Synthesis and pharmacological evaluation of 1-(aminomethyl)-3,4-dihydro-5-hydroxy-1H-2-benzopyrans as dopamine D1 selective ligands.
REF 47J Med Chem. 1990 Nov;33(11):2948-50.(1R,3S)-1-(aminomethyl)-3,4-dihydro-5,6-dihydroxy-3-phenyl-1H-2-benzopyran: a potent and selective D1 agonist.
REF 48Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6.Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands.
REF 49J Med Chem. 1982 Jul;25(7):855-8.Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain.
REF 50J Med Chem. 2004 Aug 12;47(17):4155-8.Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 receptor selectivity.
REF 51Bioorg Med Chem. 2008 Sep 15;16(18):8335-8. Epub 2008 Aug 28.N-Propylnoraporphin-11-O-yl carboxylic esters as potent dopamine D(2) and serotonin 5-HT(1A) receptor dual ligands.
REF 52J Med Chem. 1981 Sep;24(9):1107-10.Synthesis and evaluation of 1,2,3,4-tetrahydro[1]benzothieno[2,3-h]isoquinolines as dopamine antagonists.
REF 53J Nat Prod. 2000 Apr;63(4):480-4.Halogenated boldine derivatives with enhanced monoamine receptor selectivity.
REF 54J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential.
REF 55J Med Chem. 1992 Nov 13;35(23):4408-14.Synthesis and pharmacological characterization of 2-(4-chloro-3-hydroxyphenyl)ethylamine and N,N-dialkyl derivatives as dopamine receptor ligands.
REF 56J Med Chem. 1986 Oct;29(10):1904-12.Synthesis and dopaminergic binding of 2-aryldopamine analogues: phenethylamines, 3-benzazepines, and 9-(aminomethyl)fluorenes.
REF 57J Med Chem. 2006 Nov 16;49(23):6848-57.trans-2,3-dihydroxy-6a,7,8,12b-tetrahydro-6H-chromeno[3,4-c]isoquinoline: synthesis, resolution, and preliminary pharmacological characterization of a new dopamine D1 receptor full agonist.
REF 58Bioorg Med Chem. 2008 Mar 15;16(6):3218-23. Epub 2007 Dec 31.Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors.
REF 59J Med Chem. 1982 Oct;25(10):1133-40.Effects of conformationally restricted 4-piperazinyl-10H-thienobenzodiazepine neuroleptics on central dopaminergic and cholinergic systems.
REF 60J Med Chem. 1980 Jun;23(6):635-43.Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines.
REF 61Bioorg Med Chem. 2007 Nov 1;15(21):6819-29. Epub 2007 Aug 19.In vitro affinities of various halogenated benzamide derivatives as potential radioligands for non-invasive quantification of D(2)-like dopamine receptors.
REF 62J Med Chem. 1997 Dec 5;40(25):4146-53.Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic.
REF 63J Med Chem. 1981 Sep;24(9):1021-6.Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain.
REF 64Bioorg Med Chem Lett. 2009 Jan 1;19(1):51-3. Epub 2008 Nov 13.Synthesis and neuropharmacological evaluation of esters of R(-)-N-alkyl-11-hydroxy-2-methoxynoraporphines.
REF 65J Med Chem. 2008 Nov 13;51(21):6829-38. Epub 2008 Oct 4.Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies.
REF 66J Med Chem. 2005 Sep 8;48(18):5771-9.Pharmacophore-guided drug discovery investigations leading to bioactive 5-aminotetrahydropyrazolopyridines. Implications for the binding mode of heterocyclic dopamine D3 receptor agonists.
REF 67J Med Chem. 1995 Jan 20;38(2):318-27.Evaluation of cis- and trans-9- and 11-hydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridines as structurally rigid, selective D1 dopamine receptor ligands.
REF 68Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. Epub 2007 Nov 17.Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists.
REF 69J Med Chem. 1998 Nov 5;41(23):4486-91.Modified ibogaine fragments: synthesis and preliminary pharmacological characterization of 3-ethyl-5-phenyl-1,2,3,4,5, 6-hexahydroazepino[4,5-b]benzothiophenes.
REF 70J Med Chem. 1988 Oct;31(10):1941-6.Synthesis and pharmacological characterization of 1-phenyl-, 4-phenyl-, and 1-benzyl-1,2,3,4-tetrahydroisoquinolines as dopamine receptor ligands.
REF 71J Med Chem. 1990 Jun;33(6):1756-64.trans-10,11-dihydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridine: a highly potent selective dopamine D1 full agonist.
REF 72Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. Epub 2009 Aug 20.Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities?.
REF 73J Med Chem. 1998 Oct 8;41(21):4165-70.N-(Iodopropenyl)-octahydrobenzo[f]- and -[g]quinolines: synthesis and adrenergic and dopaminergic activity studies.
REF 74Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1. Nature. 1991 Apr 18;350(6319):614-9.
REF 75Adrogolide HCl (ABT-431; DAS-431), a prodrug of the dopamine D1 receptor agonist, A-86929: preclinical pharmacology and clinical data. CNS Drug Rev. 2001 Fall;7(3):305-16.
REF 76The D-1 dopamine receptor partial agonist, CY 208-243, exhibits antiparkinsonian activity in the MPTP-treated marmoset. Eur J Pharmacol. 1988 Nov 1;156(2):197-206.
REF 77Etiology of iodinated radiocontrast nephrotoxicity and its attenuation by beraprost. Yakugaku Zasshi. 2008 Jul;128(7):1023-9.
REF 78Dopamine agonists used in the treatment of Parkinson's disease and their selectivity for the D1, D2, and D3 dopamine receptors in human striatum. Prog Neuropsychopharmacol Biol Psychiatry. 1995 Nov;19(7):1147-54.
REF 79Dopamine receptor agonists: selectivity and dopamine D1 receptor efficacy. Eur J Pharmacol. 1990 Jun 12;188(6):335-47.
REF 80Identification of G protein-biased agonists that fail to recruit beta-arrestin or promote internalization of the D1 dopamine receptor. ACS Chem Neurosci. 2015 Apr 15;6(4):681-92.
REF 81Comparison of the D1-dopamine agonists SKF-38393 and A-68930 in neonatal 6-hydroxydopamine-lesioned rats: behavioral effects and induction of c-fos-like immunoreactivity. J Pharmacol Exp Ther. 1992 Aug;262(2):855-65.
REF 82(+)-[76Br]A-69024: a non-benzazepine radioligand for studies of dopamine D1 receptors using PET. Nucl Med Biol. 2002 Apr;29(3):295-302.
REF 83BIMG 80, a novel potential antipsychotic drug: evidence for multireceptor actions and preferential release of dopamine in prefrontal cortex. J Neurochem. 1997 Jul;69(1):182-90.
REF 84Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007189)
REF 85Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
REF 86SDZ GLC 756, a novel octahydrobenzo[g]quinoline derivative exerts opposing effects on dopamine D1 and D2 receptors. J Neural Transm. 1996;103(1-2):17-30.
REF 87SDZ PSD 958, a novel D1 receptor antagonist with potential limbic selectivity. J Neural Transm. 1996;103(3):261-76.
REF 88Dopamine D1 receptor involvement in the discriminative-stimulus effects of SKF 81297 in squirrel monkeys. J Pharmacol Exp Ther. 1993 Nov;267(2):765-75.
REF 89Clinical pipeline report, company report or official report of Lundbeck.
REF 90Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001476)
REF 91Characterization of benzazepine UDP-glucuronosyl-transferases in laboratory animals and man. Xenobiotica. 1995 Jun;25(6):611-22.
REF 92Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008043)
REF 93Reinforcement in an in vitro analog of appetitive classical conditioning of feeding behavior in Aplysia: blockade by a dopamine antagonist. Learn Mem. 2005 May-Jun;12(3):216-20.
REF 94PET studies of binding competition between endogenous dopamine and the D1 radiotracer [11C]NNC 756. Synapse. 1999 May;32(2):93-109.
REF 95Dopamine modulates effort-based decision making in rats. Behav Neurosci. 2009 Apr;123(2):242-51.
REF 96Effect of zelandopam, a dopamine D1-like receptor agonist, in puromycin aminonucleoside nephrosis rats. Eur J Pharmacol. 2005 Mar 7;510(1-2):121-6.
REF 97Molecular cloning and expression of the gene for a human D1 dopamine receptor. Nature. 1990 Sep 6;347(6288):72-6.
REF 98Cloning and expression of human and rat D1 dopamine receptors. Nature. 1990 Sep 6;347(6288):76-80.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.