Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T07958
|
||||
| Former ID |
TTDI01917
|
||||
| Target Name |
Erythropoietin ligand
|
||||
| Gene Name |
EPO
|
||||
| Synonyms |
Epoetin; Erythropoietin; EPO
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Anemia [ICD9: 280-285; ICD10: D50-D64] | ||||
| Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63] | |||||
| Depression; Diabetic neuropathy; Mood disorder [ICD9:311, 250, 250.6, 356.0, 356.8; ICD10: F30-F39, E11.40] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
|
||||
| UniProt ID | |||||
| Sequence |
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC
SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL KLYTGEACRTGDR |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | ARA 290 | Drug Info | Phase 2 | Depression; Diabetic neuropathy; Mood disorder | [1] |
| MK-2578 | Drug Info | Phase 2 | Anemia | [2] | |
| Erythropoietin-transfected autologous cell therapy | Drug Info | Phase 1/2 | Anemia | [3] | |
| GC-1113 | Drug Info | Phase 1 | Anemia | [4] | |
| Long-acting erythropoietin conjugate | Drug Info | Phase 1 | Anemia | [5] | |
| FC EPO | Drug Info | Discontinued in Phase 1 | Anemia | [6] | |
| GLY-515n | Drug Info | Terminated | Cerebrovascular ischaemia | [7] | |
| Modulator | ARA 290 | Drug Info | |||
| Erythropoietin-transfected autologous cell therapy | Drug Info | [8] | |||
| GC-1113 | Drug Info | [9] | |||
| GLY-515n | Drug Info | [10] | |||
| Long-acting erythropoietin conjugate | Drug Info | ||||
| Research programme: erythropoietin oral - HanAll Biopharma | Drug Info | ||||
| Agonist | FC EPO | Drug Info | [11] | ||
| MK-2578 | Drug Info | [12] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| HIF-1 signaling pathway | |||||
| PI3K-Akt signaling pathway | |||||
| Jak-STAT signaling pathway | |||||
| Hematopoietic cell lineage | |||||
| Pathway Interaction Database | HIF-2-alpha transcription factor network | ||||
| Signaling events mediated by Stem cell factor receptor (c-Kit) | |||||
| EPO signaling pathway | |||||
| HIF-1-alpha transcription factor network | |||||
| Reactome | Regulation of gene expression by Hypoxia-inducible Factor | ||||
| WikiPathways | EPO Receptor Signaling | ||||
| Hematopoietic Stem Cell Differentiation | |||||
| Differentiation Pathway | |||||
| Regulation of Hypoxia-inducible Factor (HIF) by Oxygen | |||||
| References | |||||
| REF 1 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035038) | ||||
| REF 2 | ClinicalTrials.gov (NCT00968617) A Study of MK2578 in Patients With Chronic Kidney Disease Who Are Not on Dialysis (2578-002). U.S. National Institutes of Health. | ||||
| REF 3 | ClinicalTrials.gov (NCT00542568) Safety and Efficacy of Sustained Erythropoietin Therapy. U.S. National Institutes of Health. | ||||
| REF 4 | ClinicalTrials.gov (NCT01363934) To Evaluate the Safety, Tolerability, and Pharmacokinetics/Pharmacodynamics of Erythropoietin. U.S. National Institutes of Health. | ||||
| REF 5 | ClinicalTrials.gov (NCT01030315) A Study of HM10760A (Long-acting Erythropoietin) in Healthy Adult Caucasian and Japanese Subjects. U.S. National Institutes of Health. | ||||
| REF 6 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027346) | ||||
| REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027536) | ||||
| REF 8 | Mesenchymal stromal cells engineered to express erythropoietin induce anti-erythropoietin antibodies and anemia in allorecipients. Mol Ther. 2009 Feb;17(2):369-72. doi: 10.1038/mt.2008.270. Epub 2008 Dec 16. | ||||
| REF 9 | A long-acting erythropoietin fused with noncytolytic human Fc for the treatment of anemia. Arch Pharm Res. 2012 May;35(5):757-9. | ||||
| REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027536) | ||||
| REF 11 | Detection of EPO-Fc fusion protein in human blood: screening and confirmation protocols for sports drug testing. Drug Test Anal. 2012 Nov;4(11):818-29. | ||||
| REF 12 | Merck ditches biogeneric. Nat Biotechnol. 2010 Jul;28(7):636. doi: 10.1038/nbt0710-636a. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.