Target Information

Target General Infomation
Target ID
T90782
Former ID
TTDR00731
Target Name
P2Y purinoceptor 6
Gene Name
P2RY6
Synonyms
Adenosine P2Y6 receptor; P2Y6; P2RY6
Target Type
Research
Function
Receptor for extracellular UDP > UTP > ATP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
BioChemical Class
GPCR rhodopsin
Target Validation
T90782
UniProt ID
Q15077
Sequence
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL
SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM
AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
FYFTQKKFRRRPHELLQKLTAKWQRQGR
Agonist 2MeSATP Drug Info [534141]
3-phenacyl-UDP Drug Info [528542]
5BrUTP Drug Info [534141]
adenosine diphosphate Drug Info [534141]
INS48823 Drug Info [528028]
MRS2693 Drug Info [528405]
MRS2782 Drug Info [529505]
MRS2957 Drug Info [530896]
Rp-5-OMe-UDPalphaB Drug Info [532861]
UDP-beta-S Drug Info [528028]
Up3U Drug Info [528028]
uridine triphosphate Drug Info [534141]
Antagonist MRS2567 Drug Info [527038]
MRS2578 Drug Info [527038]
Inhibitor PSB-0952 Drug Info [530711]
RB 2 Drug Info [530711]
Pathways
KEGG Pathway Neuroactive ligand-receptor interaction
Reactome G alpha (q) signalling events
P2Y receptors
WikiPathways Nucleotide GPCRs
GPCRs, Class A Rhodopsin-like
Gastrin-CREB signalling pathway via PKC and MAPK
GPCR ligand binding
GPCR downstream signaling
References
Ref 527038Diisothiocyanate derivatives as potent, insurmountable antagonists of P2Y6 nucleotide receptors. Biochem Pharmacol. 2004 May 1;67(9):1763-70.
Ref 528028P2 receptors activated by uracil nucleotides--an update. Curr Med Chem. 2006;13(3):289-312.
Ref 528405Structure-activity relationships of uridine 5'-diphosphate analogues at the human P2Y6 receptor. J Med Chem. 2006 Sep 7;49(18):5532-43.
Ref 528542Synthesis and structure-activity relationships of uracil nucleotide derivatives and analogues as agonists at human P2Y2, P2Y4, and P2Y6 receptors. J Med Chem. 2006 Nov 30;49(24):7076-87.
Ref 529505Synthesis and potency of novel uracil nucleotides and derivatives as P2Y2 and P2Y6 receptor agonists. Bioorg Med Chem. 2008 Jun 15;16(12):6319-32.
Ref 530711J Med Chem. 2010 Mar 11;53(5):2076-86.Development of potent and selective inhibitors of ecto-5'-nucleotidase based on an anthraquinone scaffold.
Ref 530896Pyrimidine ribonucleotides with enhanced selectivity as P2Y(6) receptor agonists: novel 4-alkyloxyimino, (S)-methanocarba, and 5'-triphosphate gamma-ester modifications. J Med Chem. 2010 Jun 10;53(11):4488-501.
Ref 5328615-OMe-uridine-5'-O-(alpha-boranodiphosphate), a novel nucleotide derivative highly active at the human P2Y(6) receptor protects against death-receptor mediated glial apoptosis. Neurosci Lett. 2014 Aug 22;578:80-4.
Ref 534141Cloning, functional expression and tissue distribution of the human P2Y6 receptor. Biochem Biophys Res Commun. 1996 May 15;222(2):303-8.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.