Target General Infomation
Target ID
T83011
Former ID
TTDS00341
Target Name
Amine oxidase [flavin-containing] B
Gene Name
MAOB
Synonyms
MAO-B; Monoamine oxidase; Monoamine oxidase B; MAOB
Target Type
Successful
Disease Alzheimer disease [ICD9: 331; ICD10: G30]
Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99]
Central nervous system disease [ICD10: G00-G99]
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3]
Depression; Anxiety disorder [ICD9:311, 300; ICD10: F30-F39, F32, F40-F42]
Dementia [ICD9: 290-294; ICD10: F01-F07]
Idiopathic parkinson's disease [ICD9: 332; ICD10: F02.3, G20]
Major depressive episode without melancholia [ICD10: F30-F39]
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32]
Moderate to severe hypertension [ICD10: I10-I16]
Motor symptoms; Parkinson's disease [ICD9: 332, 335.2; ICD10: F02.3, G12.2, G20]
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0]
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32]
Obesity [ICD9: 278; ICD10: E66]
Parkinson's disease [ICD9: 332; ICD10: G20]
Vitiligo [ICD9: 709.01; ICD10: L80]
Unspecified [ICD code not available]
Function
Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine.
BioChemical Class
Oxidoreductases acting on CH-NH2 group of donors
Target Validation
T83011
UniProt ID
EC Number
EC 1.4.3.4
Sequence
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Drugs and Mode of Action
Drug(s) Indeloxazine Drug Info Approved Dementia [1]
Pargyline Drug Info Approved Moderate to severe hypertension [1]
Phenelzine Drug Info Approved Depression; Anxiety disorder [2], [3], [1]
Rasagiline Drug Info Approved Parkinson's disease [4], [5]
Safinamide Drug Info Approved Parkinson's disease [6]
Selegiline Drug Info Approved Major depressive disorder [7], [8]
Selegiline Hydrochloride Drug Info Approved Parkinson's disease [1]
Tranylcypromine Drug Info Approved Major depressive episode without melancholia [1]
Psoralen Drug Info Phase 3 Discovery agent [9]
Safinamide Drug Info Phase 3 Idiopathic parkinson's disease [10], [11]
TRYPTAMINE Drug Info Phase 3 Discovery agent [12], [13]
P2B-001 Drug Info Phase 2/3 Parkinson's disease [14]
CHF-3381 Drug Info Phase 2 Neuropathic pain [15], [16]
Ladostigil Drug Info Phase 2 Alzheimer disease [17]
RG1577 Drug Info Phase 2 Alzheimer disease [18]
Neu-120 Drug Info Phase 1/2 Parkinson's disease [19]
PIPERINE Drug Info Phase 1/2 Vitiligo [20], [21]
PF9601N Drug Info Phase 1 Parkinson's disease [22]
RWJ-416457 Drug Info Preclinical Bacterial infections [23]
Lazabemide Drug Info Discontinued in Phase 3 Cognitive disorders [24], [25]
MOFEGILINE Drug Info Discontinued in Phase 3 Cognitive disorders [26]
EVT-301 Drug Info Discontinued in Phase 1 Alzheimer disease [27]
HT-1067 Drug Info Discontinued in Phase 1 Parkinson's disease [28]
SL-25.1188 Drug Info Discontinued in Phase 1 Alzheimer disease [29]
Milacemide Drug Info Terminated Alzheimer disease [30]
Inhibitor (+/-)-2-(4'-Benzyloxyphenyl)thiomorpholin-5-one Drug Info [31]
(+/-)-2-(4'-Benzyloxyphenyl)thiomorpholine Drug Info [31]
(+/-)-2-(4'-Butoxyphenyl)thiomorpholin-5-one Drug Info [31]
(+/-)-2-(4'-Butoxyphenyl)thiomorpholine Drug Info [31]
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholin-5-one Drug Info [31]
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholine Drug Info [31]
(+/-)-2-(4'-Methoxyphenyl)thiomorpholin-5-one Drug Info [31]
(+/-)-2-(4'-Methoxyphenyl)thiomorpholine Drug Info [31]
(+/-)-2-(4'-Propoxyphenyl)thiomorpholin-5-one Drug Info [31]
(+/-)-2-(4'-Propoxyphenyl)thiomorpholine Drug Info [31]
(+/-)-2-(4-fluorophenyl)-7-methoxychroman-4-one Drug Info [32]
(+/-)-2-(4-fluorophenyl)-7-methylchroman-4-one Drug Info [32]
(+/-)-2-(4-fluorophenyl)chroman-4-one Drug Info [32]
(+/-)-2-(4-methoxyphenyl)-7-methylchroman-4-one Drug Info [32]
(+/-)-2-p-tolylchroman-4-one Drug Info [32]
(+/-)-2-Phenylthiomorpholin-5-one Drug Info [31]
(+/-)-2-Phenylthiomorpholine Drug Info [31]
(+/-)-7-fluoro-2-(4-fluorophenyl)chroman-4-one Drug Info [32]
(+/-)-7-fluoro-2-(4-methoxyphenyl)chroman-4-one Drug Info [32]
(+/-)-7-fluoro-2-p-tolylchroman-4-one Drug Info [32]
(+/-)-7-fluoro-2-phenylchroman-4-one Drug Info [32]
(+/-)-7-methoxy-2-(4-methoxyphenyl)chroman-4-one Drug Info [32]
(+/-)-7-methoxy-2-p-tolylchroman-4-one Drug Info [32]
(+/-)-7-methoxy-2-phenylchroman-4-one Drug Info [32]
(+/-)-7-methyl-2-p-tolylchroman-4-one Drug Info [32]
(+/-)-7-methyl-2-phenylchroman-4-one Drug Info [32]
(6-Benzyloxy-2-naphthyl)-2-aminopropane Drug Info [33]
(6-Ethoxy-2-naphthyl)-2-aminopropane Drug Info [33]
(6-Methoxy-2-naphthyl)-2-aminopropane Drug Info [33]
(6-Propoxy-2-naphthyl)-2-aminopropane Drug Info [33]
(7-Benzyloxy-2-oxo-2H-chromen-4-yl)acetonitrile Drug Info [34]
(E)-5-(3-Chlorostyryl)isatin Drug Info [35]
(E)-5-(3-Fluorostyryl)isatin Drug Info [35]
(E)-5-Styrylisatin Drug Info [35]
(E)-6-Styrylisatin Drug Info [35]
(E)-8-(3-chlorostyryl)-caffeine Drug Info [36]
(R)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one Drug Info [32]
(R)(+)-7-fluoro-2-(4-fluorophenyl)chroman-4-one Drug Info [32]
(R)(+)-7-fluoro-2-p-tolylchroman-4-one Drug Info [32]
(R)(+)-7-fluoro-2-phenylchroman-4-one Drug Info [32]
(R)(+)-7-methyl-2-p-tolylchroman-4-one Drug Info [32]
(R)(+)-7-methyl-2-phenylchroman-4-one Drug Info [32]
(R)-3-Prop-2-ynylamino-indan-5-ol Drug Info [37]
(R)-Indan-1-yl-methyl-prop-2-ynyl-amine Drug Info [37]
(R)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}alaninamide Drug Info [38]
(R)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}serinamide Drug Info [38]
(R)-N2-{4-[(3-fluorobenzyl)oxy]benzyl}alaninamide Drug Info [38]
(R/R)BEFLOXATONE Drug Info [39]
(S)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one Drug Info [32]
(S)(+)-7-fluoro-2-(4-fluorophenyl)chroman-4-one Drug Info [32]
(S)(+)-7-fluoro-2-p-tolylchroman-4-one Drug Info [32]
(S)(+)-7-fluoro-2-phenylchroman-4-one Drug Info [32]
(S)(+)-7-methyl-2-p-tolylchroman-4-one Drug Info [32]
(S)(+)-7-methyl-2-phenylchroman-4-one Drug Info [32]
(S)-2-amino-1-(4-butylthiophenyl)-propane Drug Info [40]
(S)-2-amino-1-(4-propylthiophenyl)-propane Drug Info [40]
(S)-N2-[4-(benzyloxy)benzyl]alaninamide Drug Info [38]
(S)-N2-[4-(benzyloxy)benzyl]serinamide Drug Info [38]
(S)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}alaninamide Drug Info [38]
(S)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}serinamide Drug Info [38]
(S)-N2-{4-[(3-fluorobenzyl)oxy]benzyl}serinamide Drug Info [38]
(S)-N2-{4-[(4-chlorobenzyl)oxy]benzyl}alaninamide Drug Info [38]
(S)-N2-{4-[(4-chlorobenzyl)oxy]benzyl}serinamide Drug Info [38]
(S)-N2-{4-[(4-nitrobenzyl)oxy]benzyl}serinamide Drug Info [38]
1,2,3,4-Tetrahydro-naphthalen-1-ylamine Drug Info [41]
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole Drug Info [42]
1,4-diphenyl-(1E,3E)-1,3-butadiene Drug Info [37]
1-(4-(benzyloxy)phenyl)propan-2-amine Drug Info [33]
1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine Drug Info [43]
1H-Indole-2,3-dione Drug Info [37]
2,3,4,5-Tetrahydro-1H-pyrido[4,3-b]indole Drug Info [44]
2-(2,4-dichlorophenyl)-4,5-dihydro-1H-imidazole Drug Info [45]
2-(2-cycloheptylidenehydrazinyl)-4-phenylthiazole Drug Info [46]
2-(2-cyclohexylidenehydrazinyl)-4-p-tolylthiazole Drug Info [46]
2-(2-cyclohexylidenehydrazinyl)-4-phenylthiazole Drug Info [46]
2-(2-cyclopentylidenehydrazinyl)-4-phenylthiazole Drug Info [46]
2-(3-nitrophenyl)-4,5-dihydro-1H-imidazole Drug Info [45]
2-(4,5-dihydro-1H-imidazol-2-yl)quinoline Drug Info [45]
2-(4-chlorophenyl)-4,5-dihydro-1H-imidazole Drug Info [45]
2-(4-fluorophenyl)-7-methoxy-4H-chromen-4-one Drug Info [32]
2-(4-methoxyphenyl)-4H-chromene-4-thione Drug Info [32]
2-(5-phenyl-furan-2-yl)-4,5-dihydro-1H-imidazole Drug Info [47]
2-(naphthalen-2-yl)-4,5-dihydro-1H-imidazole Drug Info [45]
2-BFi Drug Info [45]
2-Bromo-N-(2-morpholinoethyl)nicotinamide Drug Info [48]
2-Bromo-N-(3-morpholinopropyl)nicotinamide Drug Info [48]
2-Chloro-N-(2-morpholinoethyl)nicotinamide Drug Info [48]
2-Chloro-N-(3-morpholinopropyl)nicotinamide Drug Info [48]
2-Furan-2-yl-4,5-dihydro-1H-imidazole Drug Info [49]
2-Hydrazino-3-methyl-4(3H)-quinazolinone Drug Info [50]
2-methyl-9H-indeno[2,1-d]pyrimidin-9-one Drug Info [51]
2-oxo-N-m-tolyl-2H-chromene-3-carboxamide Drug Info [52]
2-oxo-N-p-tolyl-2H-chromene-3-carboxamide Drug Info [52]
2-oxo-N-phenyl-2H-chromene-3-carboxamide Drug Info [52]
2-p-tolyl-4,5-dihydro-1H-imidazole Drug Info [45]
2-p-tolyl-4H-chromen-4-one Drug Info [32]
2-p-tolyl-4H-chromene-4-thione Drug Info [32]
2-Phenethyl-4,5-dihydro-1H-imidazole Drug Info [49]
2-Phenoxymethyl-4,5-dihydro-1H-imidazole Drug Info [49]
2-phenyl-9H-indeno[2,1-d]pyrimidine Drug Info [51]
2-Phenyl-cyclopropylamine hydrochloride Drug Info [53]
2-[7-(Benzyloxy)-2-oxo-2H-chromen-4-yl]acetamide Drug Info [34]
3,4-Benzo-7-(beta-bromoallyloxy)-8-methylcoumarin Drug Info [54]
3,4-Benzo-7-acetonyloxy-8-methoxycoumarin Drug Info [54]
3,4-Dichloro-N-(2-methyl-1H-indol-5-yl)benzamide Drug Info [55]
3-(2-Bromophenyl)-6-methylcoumarin Drug Info [56]
3-(3-methoxyphenyl)-6-methyl-2H-chromen-2-one Drug Info [57]
3-(4-hydroxyphenyl)-6-methyl-2H-chromen-2-one Drug Info [57]
3-(4-methoxyphenyl)-6-methyl-2H-chromen-2-one Drug Info [57]
3-(phenoxymethyl)-5H-indeno[1,2-c]pyridazin-5-one Drug Info [51]
3-Chloro-N-(2-methyl-1H-indol-5-yl)benzamide Drug Info [55]
3-phenyl-9H-indeno[1,2-e][1,2,4]triazin-9-one Drug Info [51]
4,8-Dimethyl-7-(2'-oxocyclohexyloxy)coumarin Drug Info [54]
4,9-Dihydro-3H-beta-carboline Drug Info [42]
4-(2-oxo-2H-chromene-3-carboxamido)benzoic acid Drug Info [52]
4-(Aminomethyl)-7-(benzyloxy)-2H-chromen-2-one Drug Info [34]
4-HYDROXY-N-PROPARGYL-1(R)-AMINOINDAN Drug Info [58]
4-methyl-7-(2-oxocyclopentyloxy)-2H-chromen-2-one Drug Info [54]
4-oxo-4H-chromene-3-carboxylic acid Drug Info [59]
4-phenyl-1,2,3,6-tetrahydropyridine Drug Info [43]
5-Aminomethyl-3-pyrrol-1-yl-oxazolidin-2-one Drug Info [39]
5-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [44]
5-Bromo-4,9-dihydro-3H-beta-carboline Drug Info [44]
5-Hydroxy-N-Propargyl-1(R)-Aminoindan Drug Info [58]
5-Hydroxymethyl-3-pyrrol-1-yl-oxazolidin-2-one Drug Info [39]
5-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [44]
5-Methoxy-4,9-dihydro-3H-beta-carboline Drug Info [44]
6-amino-9-methoxy-7H-furo[3,2-g]chromen-7-one Drug Info [54]
6-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [44]
6-Bromo-4,9-dihydro-3H-beta-carboline Drug Info [44]
6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [42]
6-Methoxy-4,9-dihydro-3H-beta-carboline Drug Info [42]
7-(3-chlorobenzyloxy)-4-carboxaldehyde-coumarin Drug Info [60]
7-Acetonyloxy-3,4-cyclohexene-8-methylcoumarin Drug Info [54]
7-Acetonyloxy-3,4-cyclopentene-8-methylcoumarin Drug Info [54]
7-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [44]
7-Bromo-4,9-dihydro-3H-beta-carboline Drug Info [44]
7-fluoro-2-(4-fluorophenyl)-4H-chromene-4-thione Drug Info [32]
7-fluoro-2-(4-methoxyphenyl)-4H-chromen-4-one Drug Info [32]
7-fluoro-2-p-tolyl-4H-chromen-4-one Drug Info [32]
7-fluoro-2-p-tolyl-4H-chromene-4-thione Drug Info [32]
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [49]
7-methoxy-2-p-tolyl-4H-chromen-4-one Drug Info [32]
7-methoxy-2-p-tolyl-4H-chromene-4-thione Drug Info [32]
7-Methoxy-9H-beta-carboline Drug Info [44]
7-methyl-2-p-tolyl-4H-chromene-4-thione Drug Info [32]
8-(3-Bromobenzyloxy)caffeine Drug Info [61]
8-(3-Chlorobenzyloxy)caffeine Drug Info [61]
8-(3-Fluorobenzyloxy)caffeine Drug Info [61]
8-(3-Methoxybenzyloxy)caffeine Drug Info [61]
8-(3-Methylbenzyloxy)caffeine Drug Info [61]
8-Benzyloxycaffeine Drug Info [61]
8-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [44]
8-Bromo-4,9-dihydro-3H-beta-carboline Drug Info [44]
8-Bromo-6-methyl-3-(4'-methoxyphenyl)coumarin Drug Info [56]
8-Bromo-6-methyl-3-phenylcoumarin Drug Info [56]
8-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [44]
8-Methoxy-4,9-dihydro-3H-beta-carboline Drug Info [44]
8-[(3-Trifluoromethyl)benzyloxy]caffeine Drug Info [61]
9-Methyl-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [44]
AS-605240 Drug Info [62]
Benzyl-methyl-[1-(1H-pyrrol-2-yl)-vinyl]-amine Drug Info [63]
Butyl-methyl-prop-2-ynyl-amine hydrochloride Drug Info [64]
C-(1H-Indol-3-yl)-methylamine Drug Info [44]
CGS-19281A Drug Info [42]
CHALCONE Drug Info [65]
CHF-3381 Drug Info [16]
Cis-2-(4-chlorophenyl)-2-fluorocyclopropanamine Drug Info [66]
Cis-2-(para-fluorophenyl)cyclopropylamine Drug Info [66]
Cis-2-Fluoro-2-(4-methoxyphenyl)cyclopropylamine Drug Info [66]
Cis-2-fluoro-2-phenylcyclopropanamine Drug Info [66]
Cis-2-phenylcyclopropylamine Drug Info [66]
CORDOIN Drug Info [65]
Deprenyl Drug Info [67]
EVT-301 Drug Info [68]
Farnesol Drug Info [58]
Flavin-Adenine Dinucleotide Drug Info [69]
Heptyl-methyl-prop-2-ynyl-amine hydrochloride Drug Info [64]
HT-1067 Drug Info [70]
HYDRAZINECARBOXAMIDE Drug Info [53]
IPRONIAZIDE Drug Info [48]
Isatin Drug Info [71]
Isopropyl-methyl-prop-2-ynyl-amine hydrochloride Drug Info [64]
Isopsoralen Drug Info [72]
JD-0100 Drug Info [73]
L-136662 Drug Info [62]
Ladostigil Drug Info [17]
Lauryl Dimethylamine-N-Oxide Drug Info [69]
Lazabemide Drug Info [74]
LAZEBEMIDE Drug Info [37]
Methyl piperate Drug Info [75]
Methyl-(1,2,3,4-tetrahydro-naphthalen-1-yl)-amine Drug Info [41]
Methyl-pentyl-prop-2-ynyl-amine oxalic acid Drug Info [64]
N-(1H-Indol-2-ylmethyl)-N-methyl-N-phenylamine Drug Info [76]
N-(1H-Indol-2-ylmethyl)-N-phenylamine Drug Info [76]
N-(2-aminoethyl)-2-oxo-2H-chromene-3-carboxamide Drug Info [52]
N-(2-AMINOETHYL)-P-CHLOROBENZAMIDE Drug Info [58]
N-(2-Methyl-1H-indol-5-yl)benzamide Drug Info [55]
N-(2-Methyl-1H-indol-5-yl)cyclohexanecarboxamide Drug Info [55]
N-(2-phenylethyl),N-(pyrrol-2-ylmethyl)amine Drug Info [77]
N-(2-Phenylethyl)-1H-indole-2-carboxamide Drug Info [76]
N-(3-Phenylpropyl)-1H-indole-2-carboxamide Drug Info [76]
N-(4-Ethylphenyl)-2-oxo-2H-chromene-3-carboxamide Drug Info [52]
N-(4-Phenylbutyl)-1H-indole-2-carboxamide Drug Info [76]
N-(benzyl),N-(pyrrol-2-ylmethyl)amine Drug Info [77]
N-(propargyl),N-(pyrrol-2-ylmethyl)amine Drug Info [77]
N-Benzyl,N-methyl-1H-indole-2-carboxamide Drug Info [76]
N-Benzyl-1H-indole-2-carboxamide Drug Info [76]
N-benzyl-2-oxo-2H-chromene-3-carboxamide Drug Info [52]
N-Benzyl-N-(1H-indol-2-ylmethyl)-N-methylamine Drug Info [76]
N-cyclohexyl-2-oxo-2H-chromene-3-carboxamide Drug Info [52]
N-isobutyl-2-oxo-2H-chromene-3-carboxamide Drug Info [52]
N-methyl,N-(benzyl),N-(pyrrol-2-ylmethyl)amine Drug Info [77]
N-methyl,N-(propargyl),N-(pyrrol-2-ylmethyl)amine Drug Info [77]
N-Methyl,N-phenyl-1H-indole-2-carboxamide Drug Info [76]
N-Methyl-N-phenyl-2-oxo-2H-chromene-3-carboxamide Drug Info [52]
N-Methyl-N-Propargyl-1(R)-Aminoindan Drug Info [58]
N-Phenyl-1H-indole-2-carboxamide Drug Info [76]
N-Propargyl-1(S)-Aminoindan Drug Info [58]
N2-[4-(benzyloxy)benzyl]glycinamide Drug Info [38]
N2-{4-[(3-chlorobenzyl)oxy]benzyl}glycinamide Drug Info [38]
N2-{4-[(3-fluorobenzyl)oxy]benzyl}glycinamide Drug Info [38]
N2-{4-[(4-chlorobenzyl)oxy]benzyl}glycinamide Drug Info [38]
N2-{4-[(4-nitrobenzyl)oxy]benzyl}glycinamide Drug Info [38]
NSC-50187 Drug Info [32]
NSC-50393 Drug Info [32]
NSC-93405 Drug Info [32]
NW-1772 Drug Info [73]
P2B-001 Drug Info [78]
Pargyline Drug Info [79]
PF9601N Drug Info [10]
Phenelzine Drug Info [80]
Phenyl 4-(4,5-dihydro-1H-imidazol-2-yl)benzoate Drug Info [45]
PIPERINE Drug Info [75]
PNU-22394 Drug Info [44]
Psoralen Drug Info [72]
Rasagiline Drug Info [81]
RS-1636 Drug Info [82]
RS-1653 Drug Info [82]
RWJ-416457 Drug Info [73]
Safinamide Drug Info [83], [84]
Selegiline Drug Info [73]
SKL-PD Drug Info [73]
SL-25.1188 Drug Info [85]
TOLOXATONE Drug Info [39]
TRACIZOLINE Drug Info [49]
Trans-2-(4-chlorophenyl)-2-fluorocyclopropanamine Drug Info [66]
Trans-2-fluoro-2-(4-fluorophenyl)cyclopropanamine Drug Info [66]
Trans-2-fluoro-2-p-tolylcyclopropanamine Drug Info [66]
Trans-2-fluoro-2-phenylcyclopropylamin Drug Info [66]
Tranylcypromine Drug Info [86], [87]
TRYPTAMINE Drug Info [44]
TRYPTOLINE Drug Info [49]
VAR-10300 Drug Info [73]
Zydis selegiline Drug Info [83]
[(1e)-4-Phenylbut-1-Enyl]Benzene Drug Info [58]
Modulator 4-fluoroselegiline Drug Info [88]
Indeloxazine Drug Info [1]
LU-53439 Drug Info
Milacemide Drug Info [30]
MOFEGILINE Drug Info [89]
Neu-120 Drug Info
RG1577 Drug Info [90]
Selegiline Hydrochloride Drug Info [91]
VAR-10200 Drug Info [73]
Antagonist 4-Methoxyamphetamine Drug Info [92]
MMDA Drug Info [69]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
BioCyc Pathway Superpathway of tryptophan utilization
Tryptophan degradation via tryptamine
Dopamine degradation
Putrescine degradation III
Noradrenaline and adrenaline degradation
KEGG Pathway Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
PANTHER Pathway Adrenaline and noradrenaline biosynthesis
5-Hydroxytryptamine degredation
Dopamine receptor mediated signaling pathway
Pathway Interaction Database Alpha-synuclein signaling
WikiPathways Tryptophan metabolism
Dopamine metabolism
Phase 1 - Functionalization of compounds
References
REF 1Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
REF 2FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011909.
REF 3(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7266).
REF 4Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54.
REF 5(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6641).
REF 6Drugs@FDA (Edaravone)
REF 7ClinicalTrials.gov (NCT00640159) Tolerability and Efficacy of Switch From Oral Selegiline to Orally Disintegrating Selegiline (Zelapar) in Patients With Parkinson's Disease. U.S. National Institutes of Health.
REF 8(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6639).
REF 9ClinicalTrials.gov (NCT01686594) PUVA Maintenance Therapy in Mycosis Fungoides. U.S. National Institutes of Health.
REF 10Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42.
REF 11(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8291).
REF 12ClinicalTrials.gov (NCT00227136) Effect of Oral 5-HTP Intake on Urinary 5-HIAA Excretion. U.S. National Institutes of Health.
REF 13(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 125).
REF 14ClinicalTrials.gov (NCT01968460) Safety, Tolerability and Efficacy of Two Doses of Once Daily P2B001 in Subjects With Early Parkinson's Disease. U.S. National Institutes of Health.
REF 15Indantadol, a novel NMDA antagonist and nonselective MAO inhibitor for the potential treatment of neuropathic pain. IDrugs. 2007 Sep;10(9):636-44.
REF 16Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
REF 17Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94.
REF 18Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026046)
REF 19ClinicalTrials.gov (NCT00607451) Safety, Tolerability, PK and PD Study of Neu-120 in the Treatment of Levodopa-induced Dyskinesia. U.S. National Institutes of Health.
REF 20ClinicalTrials.gov (NCT01383694) Effect Of Piperine In Patients With Oropharyngeal Dysphagia. U.S. National Institutes of Health.
REF 21(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2489).
REF 22CYP-dependent metabolism of PF9601N, a new monoamine oxidase-B inhibitor, by C57BL/6 mouse and human liver microsomes. J Pharm Pharm Sci. 2007;10(4):473-85.
REF 23Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016773)
REF 24(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6640).
REF 25Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004032)
REF 26Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002656)
REF 27Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024230)
REF 28Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034020)
REF 29Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012921)
REF 30Milacemide, the selective substrate and enzyme-activated specific inhibitor of monoamine oxidase B, increases dopamine but not serotonin in caudate nucleus of rhesus monkey. Neurochem Int. 1990;17(2):325-9.
REF 31Bioorg Med Chem. 2010 Feb 15;18(4):1388-95. Epub 2010 Jan 15.2-Arylthiomorpholine derivatives as potent and selective monoamine oxidase B inhibitors.
REF 32Bioorg Med Chem. 2010 Feb;18(3):1273-9. Epub 2010 Jan 4.A new series of flavones, thioflavones, and flavanones as selective monoamine oxidase-B inhibitors.
REF 33Bioorg Med Chem. 2009 Mar 15;17(6):2452-60. Epub 2009 Feb 8.Naphthylisopropylamine and N-benzylamphetamine derivatives as monoamine oxidase inhibitors.
REF 34J Med Chem. 2009 Nov 12;52(21):6685-706.Discovery of a novel class of potent coumarin monoamine oxidase B inhibitors: development and biopharmacological profiling of 7-[(3-chlorobenzyl)oxy]-4-[(methylamino)methyl]-2H-chromen-2-one methanesulfonate (NW-1772) as a highly potent, selective, reversible, and orally active monoamine oxidase B inhibitor.
REF 35Bioorg Med Chem Lett. 2009 May 1;19(9):2509-13. Epub 2009 Mar 14.Inhibition of monoamine oxidase by (E)-styrylisatin analogues.
REF 36Bioorg Med Chem. 2009 Nov 1;17(21):7523-30. Epub 2009 Sep 15.Synthesis and in vitro evaluation of pteridine analogues as monoamine oxidase B and nitric oxide synthase inhibitors.
REF 37Bioorg Med Chem Lett. 2005 Oct 15;15(20):4438-46.Docking studies on monoamine oxidase-B inhibitors: estimation of inhibition constants (K(i)) of a series of experimentally tested compounds.
REF 38J Med Chem. 2007 Oct 4;50(20):4909-16. Epub 2007 Sep 7.Solid-phase synthesis and insights into structure-activity relationships of safinamide analogues as potent and selective inhibitors of type B monoamine oxidase.
REF 39J Med Chem. 2002 Mar 14;45(6):1180-3.3-(1H-Pyrrol-1-yl)-2-oxazolidinones as reversible, highly potent, and selective inhibitors of monoamine oxidase type A.
REF 40Bioorg Med Chem. 2007 Aug 1;15(15):5198-206. Epub 2007 May 22.Human and rat monoamine oxidase-A are differentially inhibited by (S)-4-alkylthioamphetamine derivatives: insights from molecular modeling studies.
REF 41J Med Chem. 1988 Aug;31(8):1558-66.Stereoisomers of allenic amines as inactivators of monoamine oxidase type B. Stereochemical probes of the active site.
REF 42Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5.Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands.
REF 43Further explorations of unnatural alkaloids. J Nat Prod. 1985 Nov-Dec;48(6):878-93.
REF 44Bioorg Med Chem Lett. 2004 Feb 23;14(4):999-1002.Binding of beta-carbolines at imidazoline I2 receptors: a structure-affinity investigation.
REF 45Bioorg Med Chem Lett. 2009 Jan 15;19(2):546-9. Epub 2008 Mar 6.Ultrasound promoted synthesis of 2-imidazolines in water: a greener approach toward monoamine oxidase inhibitors.
REF 46Synthesis, semipreparative HPLC separation, biological evaluation, and 3D-QSAR of hydrazothiazole derivatives as human monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Jul 15;18(14):5063-70. doi: 10.1016/j.bmc.2010.05.070. Epub 2010 Jun 1.
REF 47J Med Chem. 2006 Sep 7;49(18):5578-86.3-[5-(4,5-dihydro-1H-imidazol-2-yl)-furan-2-yl]phenylamine (Amifuraline), a promising reversible and selective peripheral MAO-A inhibitor.
REF 48Bioorg Med Chem. 2010 Feb 15;18(4):1659-64. Epub 2010 Jan 4.Design of novel nicotinamides as potent and selective monoamine oxidase a inhibitors.
REF 49Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9.Binding of an imidazopyridoindole at imidazoline I2 receptors.
REF 50Bioorg Med Chem. 2009 Jan 15;17(2):675-89. Epub 2008 Dec 3.New pyrazoline bearing 4(3H)-quinazolinone inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity.
REF 51J Med Chem. 2007 Nov 1;50(22):5364-71. Epub 2007 Oct 2.Synthesis and monoamine oxidase inhibitory activity of new pyridazine-, pyrimidine- and 1,2,4-triazine-containing tricyclic derivatives.
REF 52J Med Chem. 2009 Apr 9;52(7):1935-42.Synthesis, molecular modeling, and selective inhibitory activity against human monoamine oxidases of 3-carboxamido-7-substituted coumarins.
REF 53J Med Chem. 2004 Nov 18;47(24):5860-71.Fluorinated phenylcyclopropylamines. 2. Effects of aromatic ring substitution and of absolute configuration on inhibition of microbial tyramine oxidase.
REF 54J Med Chem. 2008 Nov 13;51(21):6740-51. Epub 2008 Oct 4.Quantitative structure-activity relationship and complex network approach to monoamine oxidase A and B inhibitors.
REF 55Eur J Med Chem. 2010 Oct;45(10):4458-66. Epub 2010 Jul 31.Inhibition of monoamine oxidase by indole and benzofuran derivatives.
REF 56Bioorg Med Chem Lett. 2010 Sep 1;20(17):5157-60. Epub 2010 Jul 8.New halogenated 3-phenylcoumarins as potent and selective MAO-B inhibitors.
REF 57Bioorg Med Chem Lett. 2009 Sep 1;19(17):5053-5. Epub 2009 Jul 10.Synthesis and evaluation of 6-methyl-3-phenylcoumarins as potent and selective MAO-B inhibitors.
REF 58The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
REF 59Bioorg Med Chem Lett. 2010 May 1;20(9):2709-12. Epub 2010 Mar 27.Chromone-2- and -3-carboxylic acids inhibit differently monoamine oxidases A and B.
REF 60J Med Chem. 2007 Nov 15;50(23):5848-52. Epub 2007 Oct 4.Structures of human monoamine oxidase B complexes with selective noncovalent inhibitors: safinamide and coumarin analogs.
REF 61Bioorg Med Chem. 2010 Feb;18(3):1018-28. Epub 2010 Jan 6.Inhibition of monoamine oxidase by 8-benzyloxycaffeine analogues.
REF 62Bioorg Med Chem Lett. 2010 Sep 1;20(17):5295-8. Epub 2010 Jul 1.Identification of novel monoamine oxidase B inhibitors by structure-based virtual screening.
REF 63J Med Chem. 2003 Mar 13;46(6):917-20.Simple, potent, and selective pyrrole inhibitors of monoamine oxidase types A and B.
REF 64J Med Chem. 1992 Oct 2;35(20):3705-13.Aliphatic propargylamines: potent, selective, irreversible monoamine oxidase B inhibitors.
REF 65J Med Chem. 2009 May 14;52(9):2818-24.Chalcones: a valid scaffold for monoamine oxidases inhibitors.
REF 66Bioorg Med Chem. 2008 Aug 1;16(15):7148-66. Epub 2008 Jun 28.Fluorinated phenylcyclopropylamines. Part 5: Effects of electron-withdrawing or -donating aryl substituents on the inhibition of monoamine oxidases A and B by 2-aryl-2-fluoro-cyclopropylamines.
REF 67The effect of deprenyl washout in patients with long-standing Parkinson's disease. J Neural Transm. 2002 May;109(5-6):797-803.
REF 68Assessment of MAO-B occupancy in the brain with PET and [11C]-L-deprenyl-D2: a dose-finding study with a novel MAO-B inhibitor, EVT 301. Clin Pharmacol Ther. 2009 May;85(5):506-12.
REF 69How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
REF 70Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034020)
REF 71DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January
REF 72Inhibition of rat brain monoamine oxidase activities by psoralen and isopsoralen: implications for the treatment of affective disorders. Pharmacol Toxicol. 2001 Feb;88(2):75-80.
REF 73(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2490).
REF 74The activity of MAO A and B in rat renal cells and tubules. Life Sci. 1998;62(8):727-37.
REF 75Bioorg Med Chem Lett. 2010 Jan 15;20(2):537-40. Epub 2009 Nov 26.Proposed structural basis of interaction of piperine and related compounds with monoamine oxidases.
REF 76Bioorg Med Chem. 2008 Nov 15;16(22):9729-40. Epub 2008 Oct 2.Synthesis, structure-activity relationships and molecular modeling studies of new indole inhibitors of monoamine oxidases A and B.
REF 77J Med Chem. 2007 Mar 8;50(5):922-31. Epub 2007 Jan 26.New pyrrole inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity.
REF 78Rasagiline (TVP-1012): a new selective monoamine oxidase inhibitor for Parkinson's disease. Am J Geriatr Pharmacother. 2006 Dec;4(4):330-46.
REF 79Dose-dependent activation of distinct hypertrophic pathways by serotonin in cardiac cells. Am J Physiol Heart Circ Physiol. 2009 Aug;297(2):H821-8. Epub 2009 Jun 19.
REF 80Limitation of adipose tissue enlargement in rats chronically treated with semicarbazide-sensitive amine oxidase and monoamine oxidase inhibitors. Pharmacol Res. 2008 Jun;57(6):426-34. Epub 2008 Apr 24.
REF 81Glyceraldehyde-3-Phosphate Dehydrogenase-Monoamine Oxidase B-Mediated Cell Death-Induced by Ethanol is Prevented by Rasagiline and 1-R-Aminoindan. Neurotox Res. 2009 Aug;16(2):148-59. Epub 2009 May 28.
REF 82Novel monoamine oxidase inhibitors, 3-(2-aminoethoxy)-1,2-benzisoxazole derivatives, and their differential reversibility. Jpn J Pharmacol. 2002 Feb;88(2):174-82.
REF 83Emerging drugs for Parkinson's disease. Expert Opin Emerg Drugs. 2006 Sep;11(3):403-17.
REF 84Emerging drugs for epilepsy. Expert Opin Emerg Drugs. 2007 Sep;12(3):407-22.
REF 85[(11)C]SL25.1188, a new reversible radioligand to study the monoamine oxidase type B with PET: preclinical characterisation in nonhuman primate. Synapse. 2010 Jan;64(1):61-9.
REF 86Tranylcypromine: new perspectives on an "old" drug. Eur Arch Psychiatry Clin Neurosci. 2006 Aug;256(5):268-73.
REF 87Dopamine D2 receptors: a potential pharmacological target for nomifensine and tranylcypromine but not other antidepressant treatments. Pharmacol Biochem Behav. 1995 Aug;51(4):565-9.
REF 88Multiple, small dose administration of (-)deprenyl enhances catecholaminergic activity and diminishes serotoninergic activity in the brain and these effects are unrelated to MAO-B inhibition. Arch Int Pharmacodyn Ther. 1994 Jul-Aug;328(1):1-15.
REF 89J Med Chem. 2008 Dec 25;51(24):8019-26.Structural and mechanistic studies of mofegiline inhibition of recombinant human monoamine oxidase B.
REF 90Sembragiline Alzheimer's Disease (Phase 2). Evotech AG, Roche.
REF 91Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
REF 92Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.