Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T86271
|
||||
| Former ID |
TTDI03308
|
||||
| Target Name |
KCa2.2
|
||||
| Gene Name |
KCNN2
|
||||
| Synonyms |
KCNN2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Myeloneuropathy [ICD10: G04.1] | ||||
| Myeloma disease [ICD9: 203; ICD10: C90] | |||||
| UniProt ID | |||||
| Sequence |
MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPASVGGGGGASSPSAAAAAAAAVS
SSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGGGSGHGSSSGTKSSKKKNQNIGYK LGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTII LLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTAR LAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRF VMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIG YGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVK NAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLV DLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDFI EAQMESYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | dequalinium | Drug Info | Clinical trial | Myeloneuropathy | [1] |
| zoxazolamine | Drug Info | Terminated | Myeloma disease | [2] | |
| Blocker (channel blocker) | apamin | Drug Info | [3] | ||
| dequalinium | Drug Info | [4] | |||
| tetraethylammonium | Drug Info | [5] | |||
| UCL1684 | Drug Info | [6] | |||
| UCL1848 | Drug Info | [7] | |||
| Activator | CyPPA | Drug Info | [8] | ||
| DC-EBIO | Drug Info | [9] | |||
| EBIO | Drug Info | [5] | |||
| zoxazolamine | Drug Info | [10] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| References | |||||
| REF 1 | Pharmacological characterisation of the human small conductance calcium-activated potassium channel hSK3 reveals sensitivity to tricyclic antidepressants and antipsychotic phenothiazines. Neuropharmacology. 2001 May;40(6):772-83. | ||||
| REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2327). | ||||
| REF 3 | SK2 encodes the apamin-sensitive Ca(2+)-activated K(+) channels in the human leukemic T cell line, Jurkat. FEBS Lett. 2000 Mar 10;469(2-3):196-202. | ||||
| REF 4 | Block of rat brain recombinant SK channels by tricyclic antidepressants and related compounds. Eur J Pharmacol. 2000 Jul 28;401(1):1-7. | ||||
| REF 5 | Small conductance calcium-activated potassium channels: from structure to function. Prog Neurobiol. 2010 Jul;91(3):242-55. | ||||
| REF 6 | Pharmacological characterization of small-conductance Ca(2+)-activated K(+) channels stably expressed in HEK 293 cells. Br J Pharmacol. 2000 Mar;129(5):991-9. | ||||
| REF 7 | Calcium-activated potassium channels sustain calcium signaling in T lymphocytes. Selective blockers and manipulated channel expression levels. J Biol Chem. 2001 Apr 13;276(15):12249-56. Epub 2001 Jan 22. | ||||
| REF 8 | Selective positive modulation of the SK3 and SK2 subtypes of small conductance Ca2+-activated K+ channels. Br J Pharmacol. 2007 Jul;151(5):655-65. Epub 2007 May 8. | ||||
| REF 9 | Specific enhancement of SK channel activity selectively potentiates the afterhyperpolarizing current I(AHP) and modulates the firing properties of hippocampal pyramidal neurons. J Biol Chem. 2005 Dec16;280(50):41404-11. Epub 2005 Oct 20. | ||||
| REF 10 | Modulation of recombinant small-conductance Ca(2+)-activated K(+) channels by the muscle relaxant chlorzoxazone and structurally related compounds. J Pharmacol Exp Ther. 2001 Mar;296(3):683-9. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.