Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T69085 | Target Info | |||
Target Name | Transcription factor AP-1 (JUN) | ||||
Synonyms | V-jun avian sarcoma virus 17 oncogene homolog; Proto-oncogene c-jun; P39; C-jun proto-oncogene; Activator protein-1; Activator protein 1; AP1; AP-1 transcription factor | ||||
Target Type | Discontinued Target | ||||
Gene Name | JUN | ||||
Biochemical Class | Basic leucine zipper bZIP | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | c-Jun/c-Fos (AP-1) heterodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Leucine zipper factors (bZIP) | ||||
Family | AP-1(-like) components | ||||
Regulation Mechanism | Induction of Jun transcription in response to TPA is mediated by binding of Jun/AP-1 to a high-affinity AP-1 binding site in the Jun promoter region. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
UniProt ID | |||||
Sequence |
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Acyltransferases | [+] 1 Acyltransferases Co-regulated By This TF | + | |||
Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Endothelins/sarafotoxins | [+] 1 Endothelins/sarafotoxins Co-regulated By This TF | + | |||
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
Glucagons | [+] 1 Glucagons Co-regulated By This TF | + | |||
Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
Integrins | [+] 1 Integrins Co-regulated By This TF | + | |||
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
Somatotropin / Prolactins | [+] 1 Somatotropin / Prolactins Co-regulated By This TF | + | |||
Transcription factors | [+] 2 Transcription factors Co-regulated By This TF | + |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | The jun proto-oncogene is positively autoregulated by its product, Jun/AP-1. Cell. 1988 Dec 2;55(5):875-85. | ||||
REF 2 | Transrepression of c-jun gene expression by the glucocorticoid receptor requires both AP-1 sites in the c-jun promoter. Mol Endocrinol. 1998 Sep;12(9):1322-33. | ||||
REF 3 | Involvement of Jun and Fos proteins in regulating transcriptional activation of the human pi class glutathione S-transferase gene in multidrug-resi... J Biol Chem. 1994 Jun 10;269(23):16397-402. | ||||
REF 4 | Negative transcriptional regulation of the interferon-gamma promoter by glucocorticoids and dominant negative mutants of c-Jun. J Biol Chem. 1995 May 26;270(21):12548-56. | ||||
REF 5 | Molecular regulation of the endothelin-1 gene by hypoxia. Contributions of hypoxia-inducible factor-1, activator protein-1, GATA-2, AND p300/CBP. J Biol Chem. 2001 Apr 20;276(16):12645-53. | ||||
REF 6 | Functional mapping of a placenta-specific upstream promoter for human gonadotropin-releasing hormone receptor gene. Endocrinology. 2001 Apr;142(4):1506-16. | ||||
REF 7 | Cyclic AMP- and phorbol ester-induced transcriptional activation are mediated by the same enhancer element in the human vasoactive intestinal peptide gene. J Biol Chem. 1991 Feb 25;266(6):3882-7. | ||||
REF 8 | Composite glucocorticoid regulation at a functionally defined negative glucocorticoid response element of the human corticotropin-releasing hormone gene. Mol Endocrinol. 1999 Oct;13(10):1629-44. | ||||
REF 9 | The Megakaryocyte/Platelet-specific enhancer of the alpha2beta1 integrin gene: two tandem AP1 sites and the mitogen-activated protein kinase signal... Blood. 1999 Mar 1;93(5):1600-11. | ||||
REF 10 | Human antioxidant-response-element-mediated regulation of type 1 NAD(P)H:quinone oxidoreductase gene expression. Effect of sulfhydryl modifying age... Eur J Biochem. 1994 Nov 15;226(1):31-9. | ||||
REF 11 | Role of distinct mitogen-activated protein kinase pathways and cooperation between Ets-2, ATF-2, and Jun family members in human urokinase-type plasminogen activator gene induction by interleukin-1 and tetradecanoyl phorbol acetate. Mol Cell Biol. 1999 Sep;19(9):6240-52. | ||||
REF 12 | Thyroid hormone inhibits the human prolactin gene promoter by interfering with activating protein-1 and estrogen stimulations. Mol Endocrinol. 1997 Jun;11(7):986-96. | ||||
REF 13 | Expression of human p53 requires synergistic activation of transcription from the p53 promoter by AP-1, NF-kappaB and Myc/Max. Oncogene. 1999 Apr 29;18(17):2728-38. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.