Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T62292
(Former ID: TTDR01178)
|
|||||
Target Name |
GABA(A) receptor alpha-3 (GABRA3)
|
|||||
Synonyms |
Gamma-aminobutyric acid receptor subunit alpha-3; GABA-A receptor alpha 3; GABA(A)Gamma-aminobutyric-acid receptor alpha-3 subunit precursor receptor; GABA(A) receptor subunit alpha-3
|
|||||
Gene Name |
GABRA3
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Intentional self-harm [ICD-11: PC91] | |||||
Function |
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Click to Show/Hide
|
|||||
BioChemical Class |
Neurotransmitter receptor
|
|||||
UniProt ID | ||||||
Sequence |
MIITQTSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDS
TDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRL NQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVN YFTKRSWAWEGKKVPEALEMKKKTPAAPAKKTSTTFNIVGTTYPINLAKDTEFSTISKGA APSASSTPTIIASPKATYVQDSPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN RESAIKGMIRKQ Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T56MO9 |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
1 | Flumazenil | Drug Info | Approved | Benzodiazepine overdose | [2], [3] | |
Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
1 | Adipiplon | Drug Info | Phase 2 | Sleep-wake disorder | [4] | |
2 | GSK683699 | Drug Info | Phase 2 | Inflammatory bowel disease | [5] | |
3 | NS-2710 | Drug Info | Phase 2 | Anxiety disorder | [6] | |
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
1 | AZD6280 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [7] | |
Mode of Action | [+] 5 Modes of Action | + | ||||
Modulator (allosteric modulator) | [+] 8 Modulator (allosteric modulator) drugs | + | ||||
1 | Flumazenil | Drug Info | [1] | |||
2 | alpha3IA | Drug Info | [1] | |||
3 | alpha5IA | Drug Info | [1] | |||
4 | DMCM | Drug Info | [1] | |||
5 | tetrahydrodeoxycorticosterone | Drug Info | [1] | |||
6 | TP003 | Drug Info | [1] | |||
7 | [18F]fluoroethylflumazenil | Drug Info | [1] | |||
8 | [3H]CGS8216 | Drug Info | [1] | |||
Modulator | [+] 5 Modulator drugs | + | ||||
1 | Adipiplon | Drug Info | [8] | |||
2 | NS-2710 | Drug Info | [6] | |||
3 | AZD6280 | Drug Info | [10] | |||
4 | MK-0343 | Drug Info | [17] | |||
5 | MRK016 | Drug Info | [18] | |||
Inhibitor | [+] 28 Inhibitor drugs | + | ||||
1 | GSK683699 | Drug Info | [9] | |||
2 | (2E,4S)-4-ammoniopent-2-enoate | Drug Info | [11] | |||
3 | (4R)-4-ammoniopentanoate | Drug Info | [11] | |||
4 | (4S)-4-ammoniopentanoate | Drug Info | [11] | |||
5 | 3-(3-Methyl-butoxy)-9H-beta-carboline | Drug Info | [12] | |||
6 | 3-(benzyloxy)-9H-pyrido[3,4-b]indole | Drug Info | [12] | |||
7 | 3-(hexa-1,3-dienyloxy)-9H-pyrido[3,4-b]indole | Drug Info | [12] | |||
8 | 3-Butoxy-9H-beta-carboline | Drug Info | [12] | |||
9 | 3-Ethoxy-9H-beta-carboline | Drug Info | [12] | |||
10 | 3-Isobutoxy-9H-beta-carboline | Drug Info | [12] | |||
11 | 3-Propoxy-9H-beta-carboline | Drug Info | [12] | |||
12 | 5-[(1R)-1-ammonioethyl]isoxazol-3-olate | Drug Info | [11] | |||
13 | 5-[(1S)-1-ammonioethyl]isoxazol-3-olate | Drug Info | [11] | |||
14 | 6-benzyl-3-ethoxycarbonyl-4-quinolone | Drug Info | [13] | |||
15 | 6-bromo-3-ethoxycarbonyl-4-quinolone | Drug Info | [13] | |||
16 | 6-ethyl-3-(3-methylbutoxycarbonyl)-4-quinolone | Drug Info | [13] | |||
17 | 9H-beta-Carboline-3-carboxylic acid ethyl ester | Drug Info | [12] | |||
18 | AMENTOFLAVONE | Drug Info | [14] | |||
19 | Barbituric acid derivative | Drug Info | [15] | |||
20 | Beta-Carboline-3-carboxylic acid t-butyl ester | Drug Info | [12] | |||
21 | CI-218872 | Drug Info | [12] | |||
22 | Ethyl 6-iodo-9H-pyrido[3,4-b]indole-3-carboxylate | Drug Info | [12] | |||
23 | L-655708 | Drug Info | [16] | |||
24 | Ro-15-3505 | Drug Info | [19] | |||
25 | Ro-4938581 | Drug Info | [20] | |||
26 | RY-066 | Drug Info | [21] | |||
27 | Sec-butyl 9H-pyrido[3,4-b]indole-3-carboxylate | Drug Info | [12] | |||
28 | [3H]Ro154513 | Drug Info | [22] | |||
Agonist | [+] 2 Agonist drugs | + | ||||
1 | isonipecotic acid | Drug Info | [1] | |||
2 | piperidine-4-sulphonic acid | Drug Info | [1] | |||
Blocker (channel blocker) | [+] 2 Blocker (channel blocker) drugs | + | ||||
1 | TBPS | Drug Info | [1] | |||
2 | [35S]TBPS | Drug Info | [1] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 5 KEGG Pathways | + | ||||
1 | Neuroactive ligand-receptor interaction | |||||
2 | Retrograde endocannabinoid signaling | |||||
3 | GABAergic synapse | |||||
4 | Morphine addiction | |||||
5 | Nicotine addiction | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Ligand-gated ion channel transport | |||||
2 | GABA A receptor activation | |||||
WikiPathways | [+] 2 WikiPathways | + | ||||
1 | Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
2 | Iron uptake and transport |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 406). | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4192). | |||||
REF 3 | ClinicalTrials.gov (NCT00997087) A Randomized, Double-Blind, Placebo-Controlled Trial of Flumazenil for the Treatment of Obsessive Compulsive Disorder. U.S. National Institutes of Health. | |||||
REF 4 | ClinicalTrials.gov (NCT00683436) Efficacy and Safety Study of Adipiplon, Placebo and an Active Control in Primary Insomniacs. U.S. National Institutes of Health. | |||||
REF 5 | Emerging drugs to treat Crohn's disease. Expert Opin Emerg Drugs. 2007 Mar;12(1):49-59. | |||||
REF 6 | GABAA receptor subtype-selective modulators. I. alpha2/alpha3-selective agonists as non-sedating anxiolytics. Curr Top Med Chem. 2011;11(9):1176-202. | |||||
REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027607) | |||||
REF 8 | Discriminative stimulus properties of GABAA receptor positive allosteric modulators TPA023, ocinaplon and NG2-73 in rats trained to discriminate chlordiazepoxide or zolpidem. Eur J Pharmacol. 2011 Oct 1;668(1-2):190-3. | |||||
REF 9 | New anticonvulsants: Schiff bases of gamma-aminobutyric acid and gamma-aminobutyramide. J Med Chem. 1980 Jun;23(6):702-4. | |||||
REF 10 | AZD6280, a novel partial -aminobutyric acid A receptor modulator, demonstrates a pharmacodynamically selective effect profile in healthy male volunteers.J Clin Psychopharmacol.2015 Feb;35(1):22-33. | |||||
REF 11 | gamma-Aminobutyric acid agonists, antagonists, and uptake inhibitors. Design and therapeutic aspects. J Med Chem. 1981 Dec;24(12):1377-83. | |||||
REF 12 | Design, synthesis, and subtype selectivity of 3,6-disubstituted -carbolines at Bz/GABA(A)ergic receptors. SAR and studies directed toward agents f... Bioorg Med Chem. 2010 Nov 1;18(21):7548-64. | |||||
REF 13 | 4-quinolone derivatives: high-affinity ligands at the benzodiazepine site of brain GABA A receptors. synthesis, pharmacology, and pharmacophore mod... J Med Chem. 2006 Apr 20;49(8):2526-33. | |||||
REF 14 | Semisynthetic preparation of amentoflavone: A negative modulator at GABA(A) receptors. Bioorg Med Chem Lett. 2003 Jul 21;13(14):2281-4. | |||||
REF 15 | Whiting PJ: The GABAA receptor gene family: new opportunities for drug development. Curr Opin Drug Discov Devel. 2003 Sep;6(5):648-57. | |||||
REF 16 | 3-phenyl-6-(2-pyridyl)methyloxy-1,2,4-triazolo[3,4-a]phthalazines and analogues: high-affinity gamma-aminobutyric acid-A benzodiazepine receptor li... J Med Chem. 2004 Mar 25;47(7):1807-22. | |||||
REF 17 | Pharmacodynamic and pharmacokinetic effects of MK-0343, a GABA(A) alpha2,3 subtype selective agonist, compared to lorazepam and placebo in healthy male volunteers.J Psychopharmacol.2008 Jan;22(1):24-32. | |||||
REF 18 | A randomized clinical trial of MK-0777 for the treatment of cognitive impairments in people with schizophrenia.Biol Psychiatry.2011 Mar 1;69(5):442-9. | |||||
REF 19 | The GABA(A) receptor as a target for photochromic molecules. Bioorg Med Chem. 2010 Nov 15;18(22):7731-8. | |||||
REF 20 | The discovery and unique pharmacological profile of RO4938581 and RO4882224 as potent and selective GABAA alpha5 inverse agonists for the treatment... Bioorg Med Chem Lett. 2009 Oct 15;19(20):5940-4. | |||||
REF 21 | Predictive models for GABAA/benzodiazepine receptor subtypes: studies of quantitative structure-activity relationships for imidazobenzodiazepines a... J Med Chem. 1998 Oct 8;41(21):4130-42. | |||||
REF 22 | Synthesis and pharmacological properties of novel 8-substituted imidazobenzodiazepines: high-affinity, selective probes for alpha 5-containing GABA... J Med Chem. 1996 Apr 26;39(9):1928-34. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.