Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T58238
|
||||
| Former ID |
TTDS00453
|
||||
| Target Name |
T-lymphocyte activation antigen CD80
|
||||
| Gene Name |
CD80
|
||||
| Synonyms |
Activation B7-1 antigen; B7; BB1; CD28LG; CD28LG1; CTLA-4 counter-receptor B7.1; LAB7; CD80
|
||||
| Target Type |
Successful
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
| Non-small cell lung cancer [ICD10: C33-C34] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86] | |||||
| Function |
Involved in the costimulatory signal essential for T- lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation.
|
||||
| Target Validation |
T58238
|
||||
| UniProt ID | |||||
| Sequence |
MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELA
QTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP DNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV |
||||
| Structure |
1DR9; 1I8L
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Abatacept | Drug Info | Approved | Rheumatoid arthritis | [536737], [541949] |
| RhuDex | Drug Info | Phase 2a | Rheumatoid arthritis | [537129] | |
| Galiximab | Drug Info | Phase 2 | Lymphoma | [522087] | |
| HS-110 | Drug Info | Phase 2 | Non-small cell lung cancer | [524720] | |
| MAXY-4 | Drug Info | Phase 1 | Autoimmune diabetes | [524627] | |
| Tolerimab (anti-CD80/CD86) | Drug Info | Terminated | Transplant rejection | [546944] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cell adhesion molecules (CAMs) | ||||
| Toll-like receptor signaling pathway | |||||
| Intestinal immune network for IgA production | |||||
| Type I diabetes mellitus | |||||
| Autoimmune thyroid disease | |||||
| Systemic lupus erythematosus | |||||
| Rheumatoid arthritis | |||||
| Allograft rejection | |||||
| Graft-versus-host disease | |||||
| Viral myocarditis | |||||
| NetPath Pathway | Leptin Signaling Pathway | ||||
| RANKL Signaling Pathway | |||||
| PANTHER Pathway | T cell activation | ||||
| Pathway Interaction Database | TCR signaling in na& | ||||
| #xef | |||||
| ve CD4+ T cells | |||||
| TCR signaling in na& | |||||
| ve CD8+ T cells | |||||
| IL12 signaling mediated by STAT4 | |||||
| Reactome | PIP3 activates AKT signaling | ||||
| Constitutive Signaling by Aberrant PI3K in Cancer | |||||
| CD28 co-stimulation | |||||
| CD28 dependent PI3K/Akt signaling | |||||
| CD28 dependent Vav1 pathway | |||||
| CTLA4 inhibitory signaling | |||||
| WikiPathways | Toll-like receptor signaling pathway | ||||
| Inflammatory Response Pathway | |||||
| PIP3 activates AKT signaling | |||||
| Primary Focal Segmental Glomerulosclerosis FSGS | |||||
| Allograft Rejection | |||||
| Costimulation by the CD28 family | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| References | |||||
| Ref 522087 | ClinicalTrials.gov (NCT00516217) Galiximab in Treating Patients With Relapsed or Refractory Hodgkin's Lymphoma. U.S. National Institutes of Health. | ||||
| Ref 524627 | ClinicalTrials.gov (NCT02052375) A Study To Evaluate the Pharmacokinetics, Pharmacodynamics, Safety and Tolerability of ASP2408 After Multiple Dose Subcutaneous Injections in Patients With RheumatoidArthritis on Methotrexate. U.S. National Institutes of Health. | ||||
| Ref 524720 | ClinicalTrials.gov (NCT02117024) A Phase 2 Study of Viagenpumatucel-L (HS-110) in Patients With Non-Small Cell Lung Cancer. U.S. National Institutes of Health. | ||||
| Ref 536737 | Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54. | ||||
| Ref 537129 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | ||||
| Ref 527618 | Phase I/II study of galiximab, an anti-CD80 antibody, for relapsed or refractory follicular lymphoma. J Clin Oncol. 2005 Jul 1;23(19):4390-8. | ||||
| Ref 531427 | Trans-endocytosis of CD80 and CD86: a molecular basis for the cell-extrinsic function of CTLA-4. Science. 2011 Apr 29;332(6029):600-3. | ||||
| Ref 537606 | Selective modulation of T-cell co-stimulation: a novel mode of action for the treatment of rheumatoid arthritis. Clin Exp Rheumatol. 2009 May-Jun;27(3):510-8. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.