Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T27812
|
||||
Former ID |
TTDC00255
|
||||
Target Name |
Sodium-dependent serotonin transporter
|
||||
Gene Name |
SLC6A4
|
||||
Synonyms |
5HT transporter; 5HTT; Solute carrier family 6 member 4; SLC6A4
|
||||
Target Type |
Successful
|
||||
Disease | Appetite suppressant [ICD code not available] | ||||
Attention deficit hyperactivity disorder; Depression; Cocaine addiction [ICD9: 303-304, 304.2, 311, 314.00, 314.01; ICD10: F10-F19, F14.2, F32, F90] | |||||
Attention deficit hyperactivity disorder; Severe mood disorders [ICD9: 296, 314.00, 314.01; ICD10: F30-F39, F90] | |||||
Anesthesia; Ocular disease [ICD9:338; ICD10: R20.0, H00-H59] | |||||
Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | |||||
Attention deficit hyperactivity disorder [ICD9: 314; ICD10: F90] | |||||
Chronic low back pain; Neuropathic pain [ICD9: 338, 356.0, 356.8, 724.2, 724.5,780; ICD10: G64, G90.0, M54, M54.5, R52, G89] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Dry cough [ICD10: R05] | |||||
Depression; Attention deficit hyperactivity disorder [ICD9: 311, 314.00, 314.01; ICD10: F30-F39, F90] | |||||
Depression [ICD9: 311; ICD10: F30-F39] | |||||
Depression; Chronic pain [ICD9: 311, 338,780; ICD10: F30-F39, R52, G89] | |||||
Depressive disorders; Neuropathic pain [ICD9:296, 710.0, 356.0, 356.8; ICD10: F30-F39, M32, G64, G90.0] | |||||
Fibromyalgia [ICD9: 729.1; ICD10: M79.7] | |||||
Fibromyalgia; Myalgia; Chemotherapyinduced emesis [ICD9: 729.1, 787; ICD10: M79.1, M79.7, R11] | |||||
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
Major depressive disorder; Menopausal staging; Vasomotor symptoms [ICD9: 296, 296.2, 296.3, 627.2; ICD10: F30-F39, F32, F33, N95.0, N95.1] | |||||
Migraine; Obisity [ICD9: 278, 346; ICD10: E66, G43] | |||||
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
Major depression [ICD9: 296.2, 296.3; ICD10: F32, F33] | |||||
Mood disorder [ICD10: F30-F39] | |||||
Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89] | |||||
Obesity [ICD9: 278; ICD10: E66] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Premature ejaculation [ICD9: 302.75; ICD10: F52.4] | |||||
Smoking cessation [ICD9: 292; ICD10: F17.2] | |||||
Severe mood disorders [ICD9: 296; ICD10: F30-F39] | |||||
Schizophrenia [ICD9: 295; ICD10: F20] | |||||
Schizophrenia; Sleep maintenance insomnia [ICD9:295, 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F20, F51.0, G47.0] | |||||
Function |
Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft backinto the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner.
|
||||
BioChemical Class |
Neurotransmitter:sodium symporter
|
||||
Target Validation |
T27812
|
||||
UniProt ID | |||||
Sequence |
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT PGTFKERIIKSITPETPTEIPCGDIRLNAV |
||||
Drugs and Mode of Action | |||||
Drug(s) | Amfepramone | Drug Info | Approved | Obesity | [536103] |
Amitriptyline | Drug Info | Approved | Depression; Chronic pain | [536306], [539289], [551871] | |
Bupropion | Drug Info | Approved | Smoking cessation | [551871] | |
Chlorphentermine Hydrochloride | Drug Info | Approved | Appetite suppressant | [551871] | |
Citalopram | Drug Info | Approved | Depression | [536306], [542548] | |
Clomipramine | Drug Info | Approved | Depression | [536306], [539525] | |
Cocaine | Drug Info | Approved | Anesthesia; Ocular disease | [539436], [550681], [551871] | |
Desvenlafaxine | Drug Info | Approved | Major depressive disorder | [529941], [542166] | |
Dextromethorphan Polistirex | Drug Info | Approved | Dry cough | [551871] | |
Diethylpropion | Drug Info | Approved | Migraine; Obisity | [536661], [542170] | |
Duloxetine | Drug Info | Approved | Depression | [536306], [539298] | |
Escitalopram | Drug Info | Approved | Major depression | [551871] | |
Fluoxetine | Drug Info | Approved | Depression | [536661], [539300] | |
Fluvoxamine | Drug Info | Approved | Depression | [536120], [542200] | |
Levomilnacipran | Drug Info | Approved | Fibromyalgia | [530677], [542458] | |
Luvox | Drug Info | Approved | Anxiety disorder | [522423] | |
Nortriptyline | Drug Info | Approved | Depression | [536306], [539533] | |
Paroxetine | Drug Info | Approved | Depression | [468019], [537349] | |
Seroxat | Drug Info | Approved | Depression | [537349] | |
Sertraline | Drug Info | Approved | Depression | [468027], [536306] | |
Sibutramine | Drug Info | Approved | Obesity | [536710], [539665] | |
Tianeptine | Drug Info | Approved | Major depressive disorder | [536306], [542558], [551871] | |
Trazodone | Drug Info | Approved | Depression | [536306], [539351] | |
Ultracet | Drug Info | Approved | Pain | [536242] | |
Venlafaxine | Drug Info | Approved | Depression | [537533], [542345] | |
Vilazodone | Drug Info | Approved | Major depressive disorder | [531783], [542450] | |
Vortioxetine | Drug Info | Approved | Major depressive disorder | [532651], [542372] | |
Amitifadine | Drug Info | Phase 3 | Obesity | [527289], [528424] | |
Bicifadine | Drug Info | Phase 3 | Chronic low back pain; Neuropathic pain | [536374] | |
Dasotraline | Drug Info | Phase 3 | Mood disorder | [524969], [543060] | |
Desvenlafaxine | Drug Info | Phase 3 | Major depressive disorder; Menopausal staging; Vasomotor symptoms | [536580], [542166] | |
ITI-007 | Drug Info | Phase 3 | Schizophrenia; Sleep maintenance insomnia | [525226], [549912] | |
LITOXETINE | Drug Info | Phase 3 | Mood disorder | [544832] | |
Low dose ITI-007 | Drug Info | Phase 3 | Schizophrenia | [548546] | |
Lu-AA21004 | Drug Info | Phase 3 | Mood disorder | [532217] | |
Brasofensine | Drug Info | Phase 2 | Parkinson's disease | [526004] | |
CLR-3001 | Drug Info | Phase 2 | Major depressive disorder | [549113] | |
DA-8031 | Drug Info | Phase 2 | Premature ejaculation | [524220] | |
DOV 21947 | Drug Info | Phase 2 | Severe mood disorders | [536580] | |
Lu-AA34893 | Drug Info | Phase 2 | Anxiety disorder | [522236] | |
METHYLENEDIOXYMETHAMPHETAMINE | Drug Info | Phase 2 | Discovery agent | [521857] | |
TD-9855 | Drug Info | Phase 2 | Pain | [533083] | |
AD-337 | Drug Info | Phase 1 | Fibromyalgia; Myalgia; Chemotherapyinduced emesis | [536188] | |
AVP-786 | Drug Info | Phase 1 | Pain | [526642], [532713] | |
BGC-20-1259 | Drug Info | Phase 1 | Parkinson's disease | [526830] | |
BL-1021 | Drug Info | Phase 1 | Pain | [523040] | |
GSK-1360707 | Drug Info | Phase 1 | Major depressive disorder | [523095] | |
SEP-228432 | Drug Info | Phase 1 | Depressive disorders; Neuropathic pain | [523795] | |
Dexfenfluramine | Drug Info | Withdrawn from market | Obesity | [537068] | |
ZIMELIDINE | Drug Info | Withdrawn from market | Depression | [533389], [533528] | |
DOV-216303 | Drug Info | Discontinued in Phase 2 | Severe mood disorders | [536580] | |
GSK372475 | Drug Info | Discontinued in Phase 2 | Attention deficit hyperactivity disorder; Severe mood disorders | [533085] | |
NS 2359 | Drug Info | Discontinued in Phase 2 | Attention deficit hyperactivity disorder; Depression; Cocaine addiction | [536580] | |
NS-2389 | Drug Info | Discontinued in Phase 2 | Major depressive disorder | [546575] | |
OxycoDex | Drug Info | Discontinued in Phase 2 | Pain | [547593] | |
R-sibutramine metabolite | Drug Info | Discontinued in Phase 2 | Depression; Attention deficit hyperactivity disorder | [536580] | |
SPD-473 | Drug Info | Discontinued in Phase 2 | Mood disorder | [546832] | |
YM-992 | Drug Info | Discontinued in Phase 2 | Depression | [546447] | |
NSD-644 | Drug Info | Discontinued in Phase 1 | Neurological disease | [548670] | |
RG-7166 | Drug Info | Discontinued in Phase 1 | Major depressive disorder | [549027] | |
6-nitroquipazine | Drug Info | Terminated | Discovery agent | [546005] | |
A-80426 | Drug Info | Terminated | Discovery agent | [546043] | |
HydrocoDex | Drug Info | Terminated | Pain | [526642], [532713] | |
Irindalone | Drug Info | Terminated | Inflammatory disease | [544636] | |
MOXIFETIN HYDROGEN MALEATE | Drug Info | Terminated | Mood disorder | [544967] | |
Inhibitor | ((3R,4R)-4-(o-tolyloxy)chroman-3-yl)methanamine | Drug Info | [529620] | ||
(+/-)-3-((naphthalen-2-yloxy)methyl)pyrrolidine | Drug Info | [530012] | |||
(+/-)-nantenine | Drug Info | [530558] | |||
(2R,3R)-iodoreboxetine | Drug Info | [529666] | |||
(2R,3S)-2-[(2-Iodophenoxy)phenylmethyl]morpholine | Drug Info | [530282] | |||
(2R,3S)-2-[(3-Iodophenoxy)phenylmethyl]morpholine | Drug Info | [530282] | |||
(2R,3S)-2-[(4-Iodophenoxy)phenylmethyl]morpholine | Drug Info | [530282] | |||
(2S,3S)-iodoreboxetine | Drug Info | [529666] | |||
(cis)-1,6-diphenyl-3-aza-bicyclo[3.1.0]hexane | Drug Info | [529523] | |||
(R)-2-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol | Drug Info | [530918] | |||
(R)-3-(naphthalen-2-ylmethoxy)pyrrolidine | Drug Info | [530012] | |||
(R)-6-(pyrrolidin-3-ylmethoxy)-2-naphthonitrile | Drug Info | [530012] | |||
(R)-DULOXETINE | Drug Info | [529824] | |||
(R)-N-isobutyl-N-(pyrrolidin-3-yl)-2-naphthamide | Drug Info | [530367] | |||
(R)-N-isopropyl-N-(pyrrolidin-3-yl)-2-naphthamide | Drug Info | [530367] | |||
(R)-Norfluoxetine | Drug Info | [529814] | |||
(S)-3-(naphthalen-2-ylmethoxy)pyrrolidine | Drug Info | [530012] | |||
(S)-6-(pyrrolidin-3-ylmethoxy)-2-naphthonitrile | Drug Info | [530012] | |||
(S)-N-isobutyl-N-(pyrrolidin-3-yl)-2-naphthamide | Drug Info | [530367] | |||
(S)-NORDULOXETINE | Drug Info | [530368] | |||
(S)-Norfluoxetine | Drug Info | [529814] | |||
1-(1,2-diphenylethyl)piperazine | Drug Info | [528224] | |||
1-(1,3-diphenylpropyl)piperazine | Drug Info | [528226] | |||
1-(1,4-diphenylbutan-2-yl)piperazine | Drug Info | [528226] | |||
1-(1-(2-FLUOROPHENYL)-2-(2-(TRIFLUOROMETHOXY)PHENYL)ETHYL)PIPERAZINE (ENANTIOMERIC MIX) | Drug Info | [530918] | |||
1-(1-(4-FLUOROPHENYL)-2-(2-(TRIFLUOROMETHOXY)PHENYL)ETHYL)PIPERAZINE (ENANTIOMERIC MIX) | Drug Info | [530918] | |||
1-(1-phenyl-2-(2-propoxyphenyl)ethyl)piperazine | Drug Info | [530918] | |||
1-(1-phenyl-2-(pyridin-2-yl)ethyl)piperazine | Drug Info | [528226] | |||
1-(1-phenyl-2-(pyridin-4-yl)ethyl)piperazine | Drug Info | [528226] | |||
1-(1-phenyl-2-o-tolylethyl)piperazine | Drug Info | [528224] | |||
1-(2-((3-fluorophenoxy)methyl)phenyl)piperazine | Drug Info | [530474] | |||
1-(2-(2-(DIFLUOROMETHOXY)PHENYL)-1-PHENYLETHYL)PIPERAZINE (ENANTIOMERIC MIX) | Drug Info | [530918] | |||
1-(2-(2-bromophenyl)-1-phenylethyl)piperazine | Drug Info | [528224] | |||
1-(2-(2-chlorophenyl)-1-phenylethyl)piperazine | Drug Info | [528224] | |||
1-(2-(2-ethoxyphenyl)-1-phenylethyl)piperazine | Drug Info | [528224] | |||
1-(2-(2-ethylphenyl)-1-phenylethyl)piperazine | Drug Info | [528224] | |||
1-(2-(2-fluorobenzyloxy)phenyl)piperazine | Drug Info | [530474] | |||
1-(2-(2-methoxyphenyl)-1-phenylethyl)piperazine | Drug Info | [530918] | |||
1-(2-(3-chlorophenyl)-1-phenylethyl)piperazine | Drug Info | [528224] | |||
1-(2-(3-fluorophenoxy)phenyl)piperazine | Drug Info | [530474] | |||
1-(2-(3-methoxyphenyl)-1-phenylethyl)piperazine | Drug Info | [528224] | |||
1-(2-(4-fluorophenoxy)phenyl)piperazine | Drug Info | [530474] | |||
1-(2-(6-fluoronaphthalen-2-yl)ethyl)piperazine | Drug Info | [530012] | |||
1-(2-(benzyloxy)phenyl)piperazine | Drug Info | [530474] | |||
1-(2-(naphthalen-1-yl)-1-phenylethyl)piperazine | Drug Info | [528226] | |||
1-(2-(naphthalen-2-yl)-1-phenylethyl)piperazine | Drug Info | [528226] | |||
1-(2-(naphthalen-2-yl)ethyl)piperazine | Drug Info | [530012] | |||
1-(2-(phenoxymethyl)phenyl)piperazine | Drug Info | [530474] | |||
1-(2-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [528036] | |||
1-(2-phenoxyphenyl)piperazine | Drug Info | [530474] | |||
1-(3,4-Dichloro-phenyl)-3-diethylamino-indan-5-ol | Drug Info | [527062] | |||
1-(3,4-Dichloro-phenyl)-3-methylamino-indan-5-ol | Drug Info | [527062] | |||
1-(3,4-dichlorophenyl)-3-aza-bicyclo[3.1.0]hexane | Drug Info | [529523] | |||
1-(3-chlorophenyl)-2-(piperidin-1-yl)propan-1-one | Drug Info | [530442] | |||
1-(3-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [528036] | |||
1-(3-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [528036] | |||
1-(4-Benzylsulfanyl-phenyl)-propylamine | Drug Info | [530347] | |||
1-(4-bromophenyl)-2-(tert-butylamino)propan-1-one | Drug Info | [530728] | |||
1-(4-bromophenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [528036] | |||
1-(4-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [528036] | |||
1-(4-nitrophenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [528036] | |||
1-(benzofuran-2-yl)-3-aza-bicyclo[3.1.0]hexane | Drug Info | [529523] | |||
1-(naphthalen-2-yl)-3-aza-bicyclo[3.1.0]hexane | Drug Info | [529523] | |||
1-(thiophen-2-yl)-3-aza-bicyclo[3.1.0]hexane | Drug Info | [529523] | |||
1-benzylpiperidine hydrochloride | Drug Info | [528826] | |||
1-Biphenyl-4-yl-3-aza-bicyclo[3.1.0]hexane | Drug Info | [529523] | |||
1-fluoro-5-phenyl-3-aza-bicyclo[3.1.0]hexane | Drug Info | [529523] | |||
1-Methyl-2-(4-phenylsulfanyl-phenyl)-ethylamine | Drug Info | [530347] | |||
1-Methyl-4-p-tolyl-piperidine-4-carbonitrile | Drug Info | [525662] | |||
1-naphthalen-2-yl-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [528036] | |||
1-phenyl-3-aza-bicyclo[3.1.0]hexane | Drug Info | [529523] | |||
10R-hydroxylobel-7-ene | Drug Info | [528364] | |||
10R-hydroxylobelane | Drug Info | [528364] | |||
10S-hydroxylobel-7-ene | Drug Info | [528364] | |||
10S-hydroxylobelane | Drug Info | [528364] | |||
1S,2R-milnacipran | Drug Info | [529776] | |||
2-(2'-Aminoethyl)-5-benzyltetrahydrofuran | Drug Info | [529955] | |||
2-(2-chlorophenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [530596] | |||
2-(2-fluorophenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [530596] | |||
2-(2-methoxyphenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [530596] | |||
2-(2-phenyl-2-(piperazin-1-yl)ethyl)benzonitrile | Drug Info | [528224] | |||
2-(3-Methyl-piperazin-1-yl)-6-nitro-quinoline | Drug Info | [525836] | |||
2-(Aminomethyl)-5-(1'-naphthethyl)tetrahydrofuran | Drug Info | [529955] | |||
2-(Aminomethyl)-5-(1'-naphthyl)tetrahydrofuran | Drug Info | [529955] | |||
2-(Aminomethyl)-5-(2'-naphthyl)tetrahydrofuran | Drug Info | [529955] | |||
2-(Aminomethyl)-5-phenethyltetrahydrofuran | Drug Info | [529955] | |||
2-(N-Cyclopentylamino)-3'-methoxypropiophenone | Drug Info | [530728] | |||
2-(N-Cyclopropylamino)-3-chloropropiophenone | Drug Info | [530442] | |||
2-(N-tert-Butylamino)-3',4'-dichloropropiophenone | Drug Info | [530442] | |||
2-(tert-butylamino)-1-(3-chlorophenyl)butan-1-one | Drug Info | [530728] | |||
2-(tert-Butylamino)-3',4'-dichlorobutyrophenone | Drug Info | [530442] | |||
2-(tert-Butylamino)-3',4'-dichloropentanophenone | Drug Info | [530442] | |||
2-Amino-1-(4-ethylthiophenyl)butane | Drug Info | [530347] | |||
2-Amino-1-(4-ethylthiophenyl)propane | Drug Info | [530347] | |||
2-Amino-1-(4-methylthiophenyl)butane | Drug Info | [530347] | |||
2-Amino-1-(4-methylthiophenyl)propane | Drug Info | [530347] | |||
2-Aminomethyl-5-(p-bromophenyl)tetrahydrofuran | Drug Info | [529955] | |||
2-Aminomethyl-5-(p-chlorophenyl)tetrahydrofuran | Drug Info | [529955] | |||
2-Aminomethyl-5-(p-methoxyphenyl)tetrahydrofuran | Drug Info | [529955] | |||
2-Aminomethyl-5-(p-t-butylphenyl)tetrahydrofuran | Drug Info | [529955] | |||
2-Aminomethyl-5-(phenyl)tetrahydrofuran | Drug Info | [529955] | |||
2-N,N-Dimethylamino-1-(4-methylthiophenyl)propane | Drug Info | [530347] | |||
2-N-(Isopropyl)amino-1-(4-methylthiophenyl)butane | Drug Info | [530347] | |||
2-N-(n-Propyl)amino-1-(4-methylthiophenyl)butane | Drug Info | [530347] | |||
2-N-Allylamino-1-(4-methylthiophenyl)propan | Drug Info | [530347] | |||
2-N-Cyclopropylamino-1-(4-methylthiophenyl)butane | Drug Info | [530347] | |||
2-N-Ethylamino-1-(4-ethylthiophenyl)butane | Drug Info | [530347] | |||
2-N-Ethylamino-1-(4-ethylthiophenyl)propane | Drug Info | [530347] | |||
2-N-Ethylamino-1-(4-methylthiophenyl)butane | Drug Info | [530347] | |||
2-N-Ethylamino-1-(4-methylthiophenyl)propane | Drug Info | [530347] | |||
2-N-Hydroxyamino-1-(4-ethylthiophenyl)butane | Drug Info | [530347] | |||
2-N-Hydroxyamino-1-(4-ethylthiophenyl)propane | Drug Info | [530347] | |||
2-N-Hydroxyamino-1-(4-methylthiophenyl)butane | Drug Info | [530347] | |||
2-N-Hydroxyamino-1-(4-methylthiophenyl)propane | Drug Info | [530347] | |||
2-N-Methoxyamino-1-(4-methylthiophenyl)propane | Drug Info | [530347] | |||
2-N-Methylamino-1-(4-ethylthiophenyl)propane | Drug Info | [530347] | |||
2-N-Methylamino-1-(4-methylthiophenyl)butane | Drug Info | [530347] | |||
2-N-Methylamino-1-(4-methylthiophenyl)propane | Drug Info | [530347] | |||
2-N-Propargylamino-1-(4-methylthiophenyl)butane | Drug Info | [530347] | |||
2-N-Propargylamino-1-(4-methylthiophenyl)propane | Drug Info | [530347] | |||
2-Naphthalen-2-ylmethyl-4,5-dihydro-1H-imidazole | Drug Info | [534352] | |||
2-phenoxy-3-(piperidin-4-yl)pyridine | Drug Info | [530596] | |||
2-[1,4]Diazepan-1-yl-6-nitro-quinoline | Drug Info | [525836] | |||
3-(1H-indol-1-yl)-N-methyl-3-phenylpropan-1-amine | Drug Info | [529764] | |||
3-(1H-indol-3-yl)-N,N-dimethylpropan-1-amine | Drug Info | [529015] | |||
3-(2-phenyl-2-(piperazin-1-yl)ethyl)benzamide | Drug Info | [528224] | |||
3-(2-phenyl-2-(piperazin-1-yl)ethyl)benzonitrile | Drug Info | [528224] | |||
3-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol | Drug Info | [528224] | |||
3-(3,4-dichlorophenyl)-2-nortropene | Drug Info | [530502] | |||
3-(3-aminocyclopentyl)-1H-indole-5-carbonitrile | Drug Info | [531220] | |||
3-(4-Chlorophenyl)-2-nortropene | Drug Info | [530502] | |||
3-(4-Fluorophenyl)-2-nortropene | Drug Info | [530502] | |||
3-(4-Trifluoromethylphenyl)-2-nortropene | Drug Info | [530502] | |||
3-(piperidin-4-yl)-2-(o-tolyloxy)pyridine | Drug Info | [530596] | |||
3-alpha-Phenylmethoxy-3-beta-phenyl-nortropane | Drug Info | [530502] | |||
3-Bromo-6-nitro-2-piperazin-1-yl-quinoline | Drug Info | [525836] | |||
3-p-Tolyl-8-aza-bicyclo[3.2.1]octane | Drug Info | [525906] | |||
3-Phenyl-2-nortropene | Drug Info | [530502] | |||
3alpha-(bis-chloro-phenylmethoxy)tropane | Drug Info | [528473] | |||
4-((naphthalen-2-yloxy)methyl)piperidine | Drug Info | [530012] | |||
4-(1H-indol-3-yl)-N,N-dimethylcyclohex-3-enamine | Drug Info | [528760] | |||
4-(2-((3-fluorophenoxy)methyl)phenyl)piperidine | Drug Info | [530474] | |||
4-(2-((dimethylamino)methyl)phenoxy)benzonitrile | Drug Info | [529550] | |||
4-(2-(2-fluoro-5-methylphenoxy)phenyl)piperidine | Drug Info | [530474] | |||
4-(2-(2-fluorobenzyloxy)phenyl)piperidine | Drug Info | [530474] | |||
4-(2-(3-chlorophenoxy)phenyl)piperidine | Drug Info | [530474] | |||
4-(2-(3-fluorophenoxy)-4-methylphenyl)piperidine | Drug Info | [530474] | |||
4-(2-(3-fluorophenoxy)phenyl)piperidine | Drug Info | [530474] | |||
4-(2-(4-fluorobenzyloxy)phenyl)piperidine | Drug Info | [530474] | |||
4-(2-(4-fluorophenoxy)-4-methylphenyl)piperidine | Drug Info | [530474] | |||
4-(2-(4-fluorophenoxy)phenyl)piperidine | Drug Info | [530474] | |||
4-(2-(benzyloxy)-3-fluorophenyl)piperidine | Drug Info | [530474] | |||
4-(2-(benzyloxy)-6-fluorophenyl)piperidine | Drug Info | [530474] | |||
4-(2-(benzyloxy)phenyl)piperidine | Drug Info | [530474] | |||
4-(2-(phenoxymethyl)phenyl)piperidine | Drug Info | [530474] | |||
4-(2-fluoro-6-(2-fluorophenoxy)phenyl)piperidine | Drug Info | [530596] | |||
4-(2-fluoro-6-(3-fluorophenoxy)phenyl)piperidine | Drug Info | [530474] | |||
4-(2-fluoro-6-(4-fluorophenoxy)phenyl)piperidine | Drug Info | [530474] | |||
4-(2-fluoro-6-phenoxyphenyl)piperidine | Drug Info | [530474] | |||
4-(2-phenoxyphenyl)piperidine | Drug Info | [530474] | |||
4-(3-fluoro-2-phenoxyphenyl)piperidine | Drug Info | [530474] | |||
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
4-Allyl-6-nitro-2-piperazin-1-yl-quinoline | Drug Info | [526278] | |||
4-Benzyl-6-nitro-2-piperazin-1-yl-quinoline | Drug Info | [526278] | |||
4-Bromo-6-nitro-2-piperazin-1-yl-quinoline | Drug Info | [526278] | |||
4-Chloro-6-nitro-2-piperazin-1-yl-quinoline | Drug Info | [526278] | |||
4-Furan-2-yl-6-nitro-2-piperazin-1-yl-quinoline | Drug Info | [526278] | |||
4-Iodo-6-nitro-2-piperazin-1-yl-quinoline | Drug Info | [526278] | |||
6,6-dimethyl-1-phenyl-3-aza-bicyclo[3.1.0]hexane | Drug Info | [529523] | |||
6,8-Dinitro-2-piperazin-1-yl-quinoline | Drug Info | [525836] | |||
6-(3-aza-bicyclo[3.1.0]hexan-1-yl)quinoline | Drug Info | [529523] | |||
6-(piperidin-4-ylmethoxy)-2-naphthonitrile | Drug Info | [530012] | |||
6-Bromo-2-piperazin-1-yl-quinoline | Drug Info | [525836] | |||
6-Chloro-2-piperazin-1-yl-quinoline | Drug Info | [525836] | |||
6-Iodo-2-piperazin-1-yl-quinoline | Drug Info | [525836] | |||
6-Nitro-2-piperazin-1-yl-4-vinyl-quinoline | Drug Info | [526278] | |||
6-Nitro-4-phenyl-2-piperazin-1-yl-quinoline | Drug Info | [526278] | |||
6-nitroquipazine | Drug Info | [528747] | |||
7-(piperidin-4-ylmethoxy)-2-naphthonitrile | Drug Info | [530012] | |||
8-Methyl-3-p-tolyl-8-aza-bicyclo[3.2.1]octane | Drug Info | [525906] | |||
8R-hydroxylobel-9-ene | Drug Info | [530601] | |||
8R-hydroxylobelane | Drug Info | [528364] | |||
8S-hydroxylobel-9-ene | Drug Info | [528364] | |||
8S-hydroxylobelane | Drug Info | [528364] | |||
A-80426 | Drug Info | [534352] | |||
Amfepramone | Drug Info | [536103] | |||
Amitifadine | Drug Info | [543976] | |||
Amitriptyline | Drug Info | [536774], [537983] | |||
Beta-methoxyamphetamine | Drug Info | [530347] | |||
Biphenyl-2-ylmethyl-(S)-pyrrolidin-3-yl-amine | Drug Info | [529592] | |||
Bupropion | Drug Info | [537422] | |||
Clomipramine | Drug Info | [537225] | |||
CLR-3001 | Drug Info | [549794] | |||
Cocaine | Drug Info | [537241] | |||
COCAINE.HCL | Drug Info | [528826] | |||
Cyclohexyl-(3,4-dichloro-phenyl)-acetonitrile | Drug Info | [526591] | |||
Cyclopentyl-(3,4-dichloro-phenyl)-acetonitrile | Drug Info | [526591] | |||
D-166A | Drug Info | [529287] | |||
D-211A | Drug Info | [529287] | |||
D-211B | Drug Info | [529287] | |||
D-254C | Drug Info | [529287] | |||
D-257A | Drug Info | [529287] | |||
D-257C | Drug Info | [529287] | |||
DA-8031 | Drug Info | [532463] | |||
Dasotraline | Drug Info | [533235] | |||
Dexfenfluramine | Drug Info | [536335] | |||
Diethylpropion | Drug Info | [536130] | |||
DIFLUOROBENZTROPINE | Drug Info | [528473] | |||
DOV 21947 | Drug Info | [536580] | |||
DOV-216303 | Drug Info | [536580] | |||
Duloxetine | Drug Info | [536331], [537531] | |||
Erythro-3,4-dichloromethylphenidate hydrochloride | Drug Info | [528826] | |||
Escitalopram | Drug Info | [537557] | |||
Fluvoxamine | Drug Info | [537565], [537730] | |||
GSK-1360707 | Drug Info | [532361] | |||
GSK372475 | Drug Info | [536580] | |||
Irindalone | Drug Info | [533382] | |||
Isobutyl-(4-methyl-benzyl)-piperidin-4-yl-amine | Drug Info | [528048] | |||
JNJ-28583867 | Drug Info | [529199] | |||
KF-A5 | Drug Info | [529032] | |||
KF-A6 | Drug Info | [529032] | |||
MDL-28618 | Drug Info | [529620] | |||
METHYLENEDIOXYAMPHETAMINE | Drug Info | [530347] | |||
METHYLENEDIOXYMETHAMPHETAMINE | Drug Info | [530347] | |||
N*1*-(6-Nitro-quinolin-2-yl)-ethane-1,2-diamine | Drug Info | [525836] | |||
N,N-dimethyl(2-phenoxyphenyl)methanamine | Drug Info | [529278] | |||
N-(2-oxazolemethyl)milnacipran | Drug Info | [529263] | |||
N-(piperidin-4-yl)-N-propyl-2-naphthamide | Drug Info | [530367] | |||
N-benzyl-N-isobutylpiperidin-4-amine | Drug Info | [528048] | |||
N-cyclobutyl-N-(piperidin-4-yl)-2-naphthamide | Drug Info | [530367] | |||
NISOXETINE | Drug Info | [529824] | |||
norzotepine | Drug Info | [530783] | |||
NS 2359 | Drug Info | [536499] | |||
O-DESMETHYL TRAMADOL | Drug Info | [527832] | |||
OxycoDex | Drug Info | [526642], [532713] | |||
Para-chloroamphetamine | Drug Info | [530347] | |||
PF-18298 | Drug Info | [530918] | |||
PF-3409409 | Drug Info | [530265] | |||
PF-526014 | Drug Info | [530918] | |||
PYROVALERONE | Drug Info | [528036] | |||
QUIPAZINE | Drug Info | [525836] | |||
R-226161 | Drug Info | [528772] | |||
R-NORDULOXETINE | Drug Info | [530368] | |||
RG-7166 | Drug Info | [549028] | |||
RTI-219 | Drug Info | [528932] | |||
S-34324 | Drug Info | [527481] | |||
S33005 | Drug Info | [536286] | |||
SEP-228432 | Drug Info | [548778] | |||
Sertraline | Drug Info | [536303], [536503] | |||
SPD-473 | Drug Info | [527287] | |||
TEFLUDAZINE | Drug Info | [533519] | |||
Threo-1-aza-5-phenyl[4.4.0]decane hydrochloride | Drug Info | [528826] | |||
Threo-3,4-dichlororitalinol hydrochloride | Drug Info | [528826] | |||
Tianeptine | Drug Info | [536306] | |||
Trans-3-(o-tolyloxy)-2,3-dihydro-1H-inden-1-amine | Drug Info | [529530] | |||
Ultracet | Drug Info | [537457] | |||
Venlafaxine | Drug Info | [537422] | |||
Vortioxetine | Drug Info | [532651] | |||
WIN-35065 | Drug Info | [528932] | |||
WIN-35065-2 | Drug Info | [534240] | |||
WIN-35066-2 | Drug Info | [527309] | |||
WIN_35428 | Drug Info | [534240] | |||
YM-992 | Drug Info | [536286] | |||
ZIMELIDINE | Drug Info | [533558] | |||
[3-(3,4-Dichloro-phenyl)-indan-1-yl]-methyl-amine | Drug Info | [527062] | |||
Modulator | 3,4-Methylenedioxymethamphetamine | Drug Info | [551382] | ||
AD-337 | Drug Info | [1572591] | |||
AVP-786 | Drug Info | [526642], [532713] | |||
BGC-20-1259 | Drug Info | ||||
Bicifadine | Drug Info | ||||
BL-1021 | Drug Info | ||||
Brasofensine | Drug Info | [526004] | |||
Chlorphentermine Hydrochloride | Drug Info | ||||
Citalopram | Drug Info | [556264] | |||
Desvenlafaxine | Drug Info | [529941] | |||
Dextromethorphan Polistirex | Drug Info | [556264] | |||
Fluoxetine | Drug Info | [556264] | |||
HydrocoDex | Drug Info | [526642], [532713] | |||
Levomilnacipran | Drug Info | [530677] | |||
LITOXETINE | Drug Info | ||||
Lu-AA21004 | Drug Info | [531563], [532217], [532651] | |||
Lu-AA34893 | Drug Info | [551828] | |||
Luvox | Drug Info | [1572591] | |||
MMDA | Drug Info | [551393] | |||
Nortriptyline | Drug Info | [556264] | |||
NS-2389 | Drug Info | [550007] | |||
Paroxetine | Drug Info | [556264] | |||
R-sibutramine metabolite | Drug Info | ||||
Seroxat | Drug Info | [556264] | |||
Sibutramine | Drug Info | [556264] | |||
TD-9855 | Drug Info | [533083] | |||
Trazodone | Drug Info | [556264] | |||
Vilazodone | Drug Info | [531783] | |||
Antagonist | 4-Methoxyamphetamine | Drug Info | [551380] | ||
ITI-007 | Drug Info | [551041] | |||
Low dose ITI-007 | Drug Info | [551041] | |||
Binder | CX-1001 | Drug Info | [543976] | ||
Activator | NSD-644 | Drug Info | [550360] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Serotonergic synapse | ||||
NetPath Pathway | TCR Signaling Pathway | ||||
PANTHER Pathway | 5HT1 type receptor mediated signaling pathway | ||||
5HT2 type receptor mediated signaling pathway | |||||
5HT3 type receptor mediated signaling pathway | |||||
5HT4 type receptor mediated signaling pathway | |||||
WikiPathways | Monoamine Transport | ||||
SIDS Susceptibility Pathways | |||||
NRF2 pathway | |||||
Synaptic Vesicle Pathway | |||||
Serotonin Transporter Activity | |||||
References | |||||
Ref 468019 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4790). | ||||
Ref 468027 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4798). | ||||
Ref 521857 | ClinicalTrials.gov (NCT00353938) Study of 3,4-Methylenedioxymethamphetamine-assisted Psychotherapy in People With Posttraumatic Stress Disorder. U.S. National Institutes of Health. | ||||
Ref 522236 | ClinicalTrials.gov (NCT00622245) Efficacy and Safety of Lu AA34893 in Patients With Bipolar Depression. U.S. National Institutes of Health. | ||||
Ref 522423 | ClinicalTrials.gov (NCT00743834) Cost-Effectiveness of Adding Web-Based Cognitive-Behavioral Therapy (CBT) to Luvox CR for Obsessive Compulsive Disorder (OCD). U.S. National Institutes of Health. | ||||
Ref 523040 | ClinicalTrials.gov (NCT01121380) A Study Intended to Evaluate Safety, Tolerability and Pharmacokinetics (PK) Parameters of BL-1021. U.S. National Institutes of Health. | ||||
Ref 523095 | ClinicalTrials.gov (NCT01153802) An Open Label Positron Emission Tomography Study in Healthy Male Subjects to Investigate Brain DAT and SERT Occupancy,Pharmacokinetics and Safety of Single Oral Dosesof GSK1360707, Using 11C- PE2I and 11C-DASB as PET Ligands. U.S. National Institutes of Health. | ||||
Ref 523795 | ClinicalTrials.gov (NCT01531972) A Phase 1, Open-Label, Single-photon Emission Computed Tomography (SPECT) Study to Evaluate Serotonin and Dopamine Transporter Occupancy After Multiple Dose Administration of SEP-228432 to Achieve Steady State in Healthy Subjects. U.S. National Institutes of Health. | ||||
Ref 524220 | ClinicalTrials.gov (NCT01798667) Clinical Trial to Evaluate the Efficacy and Safety of DA-8031 in Male Patients With Premature Ejaculation. U.S. National Institutes of Health. | ||||
Ref 524969 | ClinicalTrials.gov (NCT02276209) Dasotraline Adult ADHD Study. U.S. National Institutes of Health. | ||||
Ref 525226 | ClinicalTrials.gov (NCT02469155) A Trial to Assess the Antipsychotic Efficacy of ITI-007 Over 6 Weeks of Treatment. | ||||
Ref 526642 | Dextromethorphan antagonizes the acute depletion of brain serotonin by p-chloroamphetamine and H75/12 in rats. Brain Res. 1992 Oct 30;594(2):323-6. | ||||
Ref 526830 | Pharmacological characterization of RS-1259, an orally active dual inhibitor of acetylcholinesterase and serotonin transporter, in rodents: possible treatment of Alzheimer's disease. J Pharmacol Sci.2003 Sep;93(1):95-105. | ||||
Ref 527289 | J Clin Pharmacol. 2004 Dec;44(12):1360-7.DOV 216,303, a "triple" reuptake inhibitor: safety, tolerability, and pharmacokinetic profile. | ||||
Ref 528424 | Preclinical and clinical pharmacology of DOV 216,303, a "triple" reuptake inhibitor. CNS Drug Rev. 2006 Summer;12(2):123-34. | ||||
Ref 532217 | Vortioxetine (Lu AA21004), a novel multimodal antidepressant, enhances memory in rats. Pharmacol Biochem Behav. 2013 Apr;105:41-50. | ||||
Ref 533083 | Preclinical to clinical translation of CNS transporter occupancy of TD-9855, a novel norepinephrine and serotonin reuptake inhibitor. Int J Neuropsychopharmacol. 2014 Dec 13;18(2). pii: pyu027. | ||||
Ref 533085 | Pilot Phase II study of mazindol in children with attention deficit/hyperactivity disorder. Drug Des Devel Ther. 2014 Dec 1;8:2321-32. | ||||
Ref 533389 | The effect of zimelidine, a serotonin-reuptake blocker, on cataplexy and daytime sleepiness of narcoleptic patients. Clin Neuropharmacol. 1986;9(1):46-51. | ||||
Ref 533528 | Pharmacokinetic study of zimelidine using a new GLC method. Clin Pharmacokinet. 1983 Nov-Dec;8(6):530-40. | ||||
Ref 536120 | Autism spectrum disorders: emerging pharmacotherapy. Expert Opin Emerg Drugs. 2005 Aug;10(3):521-36. | ||||
Ref 536188 | Emerging drugs for chemotherapy-induced emesis. Expert Opin Emerg Drugs. 2006 Mar;11(1):137-51. | ||||
Ref 536242 | The Diversion of Ultram, Ultracet, and generic tramadol HCL. J Addict Dis. 2006;25(2):53-8. | ||||
Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
Ref 536661 | Anti-obesity drugs and neural circuits of feeding. Trends Pharmacol Sci. 2008 Apr;29(4):208-17. Epub 2008 Mar 18. | ||||
Ref 537349 | Emerging drug therapies in Huntington's disease. Expert Opin Emerg Drugs. 2009 Jun;14(2):273-97. | ||||
Ref 537533 | Desvenlafaxine in the treatment of major depressive disorder. Neuropsychiatr Dis Treat. 2009;5:127-36. Epub 2009 Apr 8. | ||||
Ref 539289 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 200). | ||||
Ref 539298 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 202). | ||||
Ref 539300 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 203). | ||||
Ref 539351 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 213). | ||||
Ref 539436 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2286). | ||||
Ref 539525 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2398). | ||||
Ref 539533 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2404). | ||||
Ref 539665 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2586). | ||||
Ref 542166 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7158). | ||||
Ref 542170 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7161). | ||||
Ref 542200 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7189). | ||||
Ref 542345 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7321). | ||||
Ref 542372 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7351). | ||||
Ref 542450 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7427). | ||||
Ref 542458 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7435). | ||||
Ref 542548 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7547). | ||||
Ref 542558 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7558). | ||||
Ref 543060 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8308). | ||||
Ref 544636 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000378) | ||||
Ref 544832 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001264) | ||||
Ref 544967 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001731) | ||||
Ref 546005 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005841) | ||||
Ref 546043 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006017) | ||||
Ref 546447 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008166) | ||||
Ref 546575 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009012) | ||||
Ref 546832 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010517) | ||||
Ref 547593 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017613) | ||||
Ref 548546 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026498) | ||||
Ref 548670 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027571) | ||||
Ref 549027 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031598) | ||||
Ref 525355 | Moxidectin causes adult worm mortality of human lymphatic filarial parasite Brugia malayi in rodent models. Folia Parasitol (Praha). 2014 Dec;61(6):561-70. | ||||
Ref 525662 | Bioorg Med Chem Lett. 1999 Dec 6;9(23):3273-6.Synthesis, dopamine and serotonin transporter binding affinities of novel analogues of meperidine. | ||||
Ref 525836 | Bioorg Med Chem Lett. 2000 Jul 17;10(14):1559-62.Syntheses and binding affinities of 6-nitroquipazine analogues for serotonin transporter. Part 1. | ||||
Ref 525906 | Bioorg Med Chem Lett. 2000 Nov 6;10(21):2445-7.3alpha-(4-Substituted phenyl)nortropane-2beta-carboxylic acid methyl esters show selective binding at the norepinephrine transporter. | ||||
Ref 526278 | Bioorg Med Chem Lett. 2002 Mar 11;12(5):811-5.Syntheses and binding affinities of 6-nitroquipazine analogues for serotonin transporter. Part 2: 4-substituted 6-nitroquipazines. | ||||
Ref 526591 | J Med Chem. 2003 Apr 10;46(8):1538-45.Synthesis and evaluation of dopamine and serotonin transporter inhibition by oxacyclic and carbacyclic analogues of methylphenidate. | ||||
Ref 526642 | Dextromethorphan antagonizes the acute depletion of brain serotonin by p-chloroamphetamine and H75/12 in rats. Brain Res. 1992 Oct 30;594(2):323-6. | ||||
Ref 527062 | J Med Chem. 2004 May 6;47(10):2624-34.Synthesis and pharmacological evaluation of 3-(3,4-dichlorophenyl)-1-indanamine derivatives as nonselective ligands for biogenic amine transporters. | ||||
Ref 527287 | Dopamine uptake inhibitor-induced rotation in 6-hydroxydopamine-lesioned rats involves both D1 and D2 receptors but is modulated through 5-hydroxytryptamine and noradrenaline receptors. J Pharmacol Exp Ther. 2005 Mar;312(3):1124-31. Epub 2004 Nov 12. | ||||
Ref 527309 | J Med Chem. 2004 Dec 2;47(25):6401-9.Monoamine transporter binding, locomotor activity, and drug discrimination properties of 3-(4-substituted-phenyl)tropane-2-carboxylic acid methyl ester isomers. | ||||
Ref 527481 | J Med Chem. 2005 Mar 24;48(6):2054-71.Discovery of a new series of centrally active tricyclic isoxazoles combining serotonin (5-HT) reuptake inhibition with alpha2-adrenoceptor blocking activity. | ||||
Ref 527832 | Bioorg Med Chem Lett. 2006 Feb;16(3):691-4. Epub 2005 Oct 27.Derivatives of tramadol for increased duration of effect. | ||||
Ref 528036 | J Med Chem. 2006 Feb 23;49(4):1420-32.1-(4-Methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one (Pyrovalerone) analogues: a promising class of monoamine uptake inhibitors. | ||||
Ref 528048 | Bioorg Med Chem Lett. 2006 May 15;16(10):2714-8. Epub 2006 Feb 23.N-Alkyl-N-arylmethylpiperidin-4-amines: novel dual inhibitors of serotonin and norepinephrine reuptake. | ||||
Ref 528224 | Bioorg Med Chem Lett. 2006 Aug 15;16(16):4345-8. Epub 2006 Jun 5.N-(1,2-diphenylethyl)piperazines: a new class of dual serotonin/noradrenaline reuptake inhibitor. | ||||
Ref 528226 | Bioorg Med Chem Lett. 2006 Aug 15;16(16):4349-53. Epub 2006 Jun 5.Structure-activity relationships of N-substituted piperazine amine reuptake inhibitors. | ||||
Ref 528364 | Bioorg Med Chem Lett. 2006 Oct 1;16(19):5018-21. Epub 2006 Aug 14.Des-keto lobeline analogs with increased potency and selectivity at dopamine and serotonin transporters. | ||||
Ref 528473 | J Med Chem. 2006 Oct 19;49(21):6391-9.Structure-activity relationship studies on a novel series of (S)-2beta-substituted 3alpha-[bis(4-fluoro- or 4-chlorophenyl)methoxy]tropane analogues for in vivo investigation. | ||||
Ref 528747 | Bioorg Med Chem. 2007 May 15;15(10):3499-504. Epub 2007 Mar 3.Syntheses and binding affinities of 6-nitroquipazine analogues for serotonin transporter. Part 5: 2'-Substituted 6-nitroquipazines. | ||||
Ref 528760 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3099-104. Epub 2007 Mar 16.Conformationally restricted homotryptamines 3. Indole tetrahydropyridines and cyclohexenylamines as selective serotonin reuptake inhibitors. | ||||
Ref 528772 | Bioorg Med Chem. 2007 Jun 1;15(11):3649-60. Epub 2007 Mar 21.Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-adrenoceptor antagonism. | ||||
Ref 528826 | J Med Chem. 2007 May 31;50(11):2718-31. Epub 2007 May 10.Synthesis and pharmacology of site-specific cocaine abuse treatment agents: restricted rotation analogues of methylphenidate. | ||||
Ref 528932 | J Med Chem. 2007 Jul 26;50(15):3686-95. Epub 2007 Jun 30.Synthesis, monoamine transporter binding, properties, and functional monoamine uptake activity of 3beta-[4-methylphenyl and 4-chlorophenyl]-2beta-[5-(substituted phenyl)thiazol-2-yl]tropanes. | ||||
Ref 529015 | Bioorg Med Chem Lett. 2007 Oct 15;17(20):5647-51. Epub 2007 Aug 22.Conformationally restricted homotryptamines. Part 4: Heterocyclic and naphthyl analogs of a potent selective serotonin reuptake inhibitor. | ||||
Ref 529032 | Antimicrob Agents Chemother. 2007 Nov;51(11):4133-40. Epub 2007 Sep 10.Design, synthesis, and evaluation of 10-N-substituted acridones as novel chemosensitizers in Plasmodium falciparum. | ||||
Ref 529199 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):39-43. Epub 2007 Nov 13.Synthesis and biological activity of piperazine and diazepane amides that are histamine H3 antagonists and serotonin reuptake inhibitors. | ||||
Ref 529263 | Bioorg Med Chem Lett. 2008 Feb 15;18(4):1346-9. Epub 2008 Jan 9.Studies on the SAR and pharmacophore of milnacipran derivatives as monoamine transporter inhibitors. | ||||
Ref 529278 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):596-9.1-(2-Phenoxyphenyl)methanamines: SAR for dual serotonin/noradrenaline reuptake inhibition, metabolic stability and hERG affinity. | ||||
Ref 529287 | Bioorg Med Chem. 2008 Mar 15;16(6):2769-78. Epub 2008 Jan 11.Further structural optimization of cis-(6-benzhydryl-piperidin-3-yl)-benzylamine and 1,4-diazabicyclo[3.3.1]nonane derivatives by introducing an exocyclic hydroxyl group: interaction with dopamine, serotonin, and norepinephrine transporters. | ||||
Ref 529523 | Bioorg Med Chem Lett. 2008 Jul 1;18(13):3682-6. Epub 2008 May 23.Studies on the structure-activity relationship of bicifadine analogs as monoamine transporter inhibitors. | ||||
Ref 529530 | Bioorg Med Chem Lett. 2008 Jul 15;18(14):4224-7. Epub 2008 May 20.Discovery of a potent, selective, and less flexible selective norepinephrine reuptake inhibitor (sNRI). | ||||
Ref 529550 | Bioorg Med Chem Lett. 2008 Jul 15;18(14):4018-21. Epub 2008 Jun 5.Designing rapid onset selective serotonin re-uptake inhibitors. 2: structure-activity relationships of substituted (aryl)benzylamines. | ||||
Ref 529592 | Bioorg Med Chem Lett. 2008 Aug 1;18(15):4355-9. Epub 2008 Jun 25.Derivatives of (3S)-N-(biphenyl-2-ylmethyl)pyrrolidin-3-amine as selective noradrenaline reuptake inhibitors: Reducing P-gp mediated efflux by modulation of H-bond acceptor capacity. | ||||
Ref 529620 | Bioorg Med Chem Lett. 2008 Aug 15;18(16):4495-8. Epub 2008 Jul 17.Synthesis and structure-activity relationships of selective norepinephrine reuptake inhibitors (sNRI) with a heterocyclic ring constraint. | ||||
Ref 529666 | Bioorg Med Chem Lett. 2008 Sep 15;18(18):4940-3. Epub 2008 Aug 19.New iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. | ||||
Ref 529764 | Bioorg Med Chem Lett. 2008 Dec 1;18(23):6067-70. Epub 2008 Oct 11.Synthesis and activity of novel 1- or 3-(3-amino-1-phenyl propyl)-1,3-dihydro-2H-benzimidazol-2-ones as selective norepinephrine reuptake inhibitors. | ||||
Ref 529776 | J Med Chem. 2008 Nov 27;51(22):7265-72.Characterization of thien-2-yl 1S,2R-milnacipran analogues as potent norepinephrine/serotonin transporter inhibitors for the treatment of neuropathic pain. | ||||
Ref 529814 | Bioorg Med Chem. 2009 Jan 1;17(1):337-43. Epub 2008 Nov 5.Stereoselective inhibition of serotonin re-uptake and phosphodiesterase by dual inhibitors as potential agents for depression. | ||||
Ref 529824 | Bioorg Med Chem Lett. 2009 Jan 1;19(1):58-61. Epub 2008 Nov 13.1-Naphthyl and 4-indolyl arylalkylamines as selective monoamine reuptake inhibitors. | ||||
Ref 529955 | Bioorg Med Chem. 2009 Mar 1;17(5):2047-68. Epub 2009 Jan 15.2,5-Disubstituted tetrahydrofurans as selective serotonin re-uptake inhibitors. | ||||
Ref 530012 | Bioorg Med Chem Lett. 2009 Apr 15;19(8):2329-32. Epub 2009 Feb 20.Design and optimization of selective serotonin re-uptake inhibitors with high synthetic accessibility. Part 1. | ||||
Ref 530265 | Bioorg Med Chem Lett. 2009 Aug 15;19(16):4579-83. Epub 2009 Jul 2.Design, synthesis and evaluation of N-[(3S)-pyrrolidin-3-yl]benzamides as selective noradrenaline reuptake inhibitors: CNS penetration in a more polar template. | ||||
Ref 530282 | Bioorg Med Chem Lett. 2009 Sep 1;19(17):4996-8. Epub 2009 Jul 16.Design and synthesis of (2R,3S)-iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. | ||||
Ref 530347 | Eur J Med Chem. 2009 Dec;44(12):4862-88. Epub 2009 Aug 6.Synthesis and serotonin transporter activity of sulphur-substituted alpha-alkyl phenethylamines as a new class of anticancer agents. | ||||
Ref 530367 | Bioorg Med Chem Lett. 2009 Oct 15;19(20):5893-7. Epub 2009 Aug 21.Design and optimisation of selective serotonin re-uptake inhibitors with high synthetic accessibility: part 2. | ||||
Ref 530368 | Bioorg Med Chem. 2009 Oct 1;17(19):6890-7. Epub 2009 Aug 20.Inhibition of serotonin and norepinephrine reuptake and inhibition of phosphodiesterase by multi-target inhibitors as potential agents fordepression. | ||||
Ref 530442 | J Med Chem. 2009 Nov 12;52(21):6768-81.Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for cocaine addiction. | ||||
Ref 530474 | Bioorg Med Chem Lett. 2009 Dec 1;19(23):6604-7. Epub 2009 Oct 12.Discovery and pharmacological characterization of aryl piperazine and piperidine ethers as dual acting norepinephrine reuptake inhibitors and 5-HT1A partial agonists. | ||||
Ref 530502 | Bioorg Med Chem Lett. 2009 Dec 15;19(24):6865-8. Epub 2009 Oct 23.Synthesis and monoamine transporter affinity of 3alpha-arylmethoxy-3beta-arylnortropanes. | ||||
Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
Ref 530596 | Bioorg Med Chem Lett. 2010 Feb 1;20(3):1114-7. Epub 2009 Dec 6.Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agonists. | ||||
Ref 530601 | Bioorg Med Chem. 2010 Jan 15;18(2):640-9. Epub 2009 Dec 6.Lobeline esters as novel ligands for neuronal nicotinic acetylcholine receptors and neurotransmitter transporters. | ||||
Ref 530728 | J Med Chem. 2010 Mar 11;53(5):2204-14.Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for smoking cessation. | ||||
Ref 530783 | Norzotepine, a major metabolite of zotepine, exerts atypical antipsychotic-like and antidepressant-like actions through its potent inhibition of norepinephrine reuptake. J Pharmacol Exp Ther. 2010 Jun;333(3):772-81. | ||||
Ref 530918 | Bioorg Med Chem Lett. 2010 Jun 15;20(12):3788-92. Epub 2010 Apr 18.Second generation N-(1,2-diphenylethyl)piperazines as dual serotonin and noradrenaline reuptake inhibitors: improving metabolic stability and reducing ion channel activity. | ||||
Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
Ref 531220 | J Med Chem. 2010 Nov 11;53(21):7564-72.Conformationally restricted homotryptamines. Part 7: 3-cis-(3-aminocyclopentyl)indoles as potent selective serotonin reuptake inhibitors. | ||||
Ref 531563 | A double-blind, randomized, placebo-controlled, active reference study of Lu AA21004 in patients with major depressive disorder. Int J Neuropsychopharmacol. 2012 Jun;15(5):589-600. | ||||
Ref 532217 | Vortioxetine (Lu AA21004), a novel multimodal antidepressant, enhances memory in rats. Pharmacol Biochem Behav. 2013 Apr;105:41-50. | ||||
Ref 532361 | Monoamine transporter occupancy of a novel triple reuptake inhibitor in baboons and humans using positron emission tomography. J Pharmacol Exp Ther. 2013 Aug;346(2):311-7. | ||||
Ref 532463 | Effect of DA-8031, a novel oral compound for premature ejaculation, on male rat sexual behavior. Int J Urol. 2014 Mar;21(3):325-9. | ||||
Ref 533083 | Preclinical to clinical translation of CNS transporter occupancy of TD-9855, a novel norepinephrine and serotonin reuptake inhibitor. Int J Neuropsychopharmacol. 2014 Dec 13;18(2). pii: pyu027. | ||||
Ref 533235 | Dasotraline for the Treatment of Attention-Deficit/Hyperactivity Disorder: A Randomized, Double-Blind, Placebo-Controlled, Proof-of-Concept Trial in Adults. Neuropsychopharmacology. 2015 Nov;40(12):2745-52. | ||||
Ref 533382 | J Med Chem. 1988 Dec;31(12):2247-56.Antihypertensive activity in a series of 1-piperazino-3-phenylindans with potent 5-HT2-antagonistic activity. | ||||
Ref 533519 | J Med Chem. 1983 Jul;26(7):935-47.Neuroleptic activity and dopamine-uptake inhibition in 1-piperazino-3-phenylindans. | ||||
Ref 533558 | J Med Chem. 1984 Nov;27(11):1508-15.Nontricyclic antidepressant agents derived from cis- and trans-1-amino-4-aryltetralins. | ||||
Ref 534240 | J Med Chem. 1996 Oct 11;39(21):4139-41.3 alpha-(4'-substituted phenyl)tropane-2 beta-carboxylic acid methyl esters: novel ligands with high affinity and selectivity at the dopamine transporter. | ||||
Ref 534352 | J Med Chem. 1997 Mar 28;40(7):1049-62.Structure-activity studies for a novel series of N-(arylethyl)-N-(1,2,3,4-tetrahydronaphthalen-1-ylmethyl)-N-methylamine s possessing dual 5-HT uptake inhibitingand alpha2-antagonistic activities. | ||||
Ref 536286 | Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23. | ||||
Ref 536303 | Methadone: from pharmacokinetic profile to clinical pharmacology. Encephale. 2006 Jul-Aug;32(4 Pt 1):478-86. | ||||
Ref 536331 | Multi-target therapeutics: when the whole is greater than the sum of the parts. Drug Discov Today. 2007 Jan;12(1-2):34-42. Epub 2006 Nov 28. | ||||
Ref 536335 | Serotonergic drugs : effects on appetite expression and use for the treatment of obesity. Drugs. 2007;67(1):27-55. | ||||
Ref 536499 | Emerging drugs for attention-deficit/hyperactivity disorder. Expert Opin Emerg Drugs. 2007 Sep;12(3):423-34. | ||||
Ref 536503 | Psychopharmacological treatment of dermatological patients--when simply talking does not help. J Dtsch Dermatol Ges. 2007 Dec;5(12):1101-6. Epub 2007 Sep 17. | ||||
Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
Ref 536774 | Treatment of comorbid pain with serotonin norepinephrine reuptake inhibitors. CNS Spectr. 2008 Jul;13(7 Suppl 11):22-6. | ||||
Ref 537225 | Efficacy of treatments for patients with obsessive-compulsive disorder: a systematic review. J Am Acad Nurse Pract. 2009 Apr;21(4):207-13. | ||||
Ref 537241 | Differential involvement of the norepinephrine, serotonin and dopamine reuptake transporter proteins in cocaine-induced taste aversion. Pharmacol Biochem Behav. 2009 Jul;93(1):75-81. Epub 2009 Apr 17. | ||||
Ref 537422 | Clinically relevant drug interactions with new generation antidepressants and antipsychotics. Ther Umsch. 2009 Jun;66(6):485-92. | ||||
Ref 537457 | Augmentation effect of combination therapy of aripiprazole and antidepressants on forced swimming test in mice. Psychopharmacology (Berl). 2009 Jun 11. | ||||
Ref 537531 | Duloxetine for the treatment of generalized anxiety disorder: a review. Neuropsychiatr Dis Treat. 2009;5:23-31. Epub 2009 Apr 8. | ||||
Ref 537565 | Changes of functional MRI findings in a patient whose pathological gambling improved with fluvoxamine. Yonsei Med J. 2009 Jun 30;50(3):441-4. Epub 2009 Jun 24. | ||||
Ref 537730 | Placebo controlled double-blind trial of fluvoxamine maleate in the obese. J Psychosom Res. 1986;30(2):143-6. | ||||
Ref 537983 | A non-selective (amitriptyline), but not a selective (citalopram), serotonin reuptake inhibitor is effective in the prophylactic treatment of chronic tension-type headache. J Neurol Neurosurg Psychiatry. 1996 Sep;61(3):285-90. | ||||
Ref 543976 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 928). | ||||
Ref 548778 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028715) | ||||
Ref 549028 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031598) | ||||
Ref 550360 | NSD-644: Phase I started.NeuroSearch A/S (CSE:NEUR), Ballerup, Denmark, GlaxoSmithKline plc (LSE:GSK; GSK), London, U.K. | ||||
Ref 551041 | Clinical pipeline report, company report or official report of Intra-Cellular Therapies, Inc. | ||||
Ref 551380 | Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77. | ||||
Ref 551382 | The origin of <span class="caps">MDMA</span> (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.