Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T52921
|
||||
Former ID |
TTDR01247
|
||||
Target Name |
Nociceptin receptor
|
||||
Gene Name |
OPRL1
|
||||
Synonyms |
KOR-3; Kappa-type 3 opioid receptor; OP(4); ORL-1; ORL-1 receptor; Opioid receptor 4; Opioid receptor like-1 receptor; Opioid-receptor-like 1; Orphanin FQ receptor; OPRL1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | ||||
Central nervous system disease [ICD10: G00-G99] | |||||
Heart failure [ICD9: 428; ICD10: I50] | |||||
Headache [ICD9: 339, 784.0; ICD10: G43-G44, R51] | |||||
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Psychiatric disorder [ICD9: 290-319; ICD10: F01-F99] | |||||
Pain; Stress [ICD9: 300, 338,780; ICD10: F40-F42, R52, G89] | |||||
Function |
G-protein coupled opioid receptor that functions as receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling via G proteins mediates inhibition of adenylate cyclase activity and calcium channel activity. Arrestins modulate signaling via G proteins and mediate the activation of alternative signaling pathways that lead to the activation of MAP kinases. Plays a role in modulating nociception and the perception of pain. Plays a role in the regulation of locomotor activity by the neuropeptide nociceptin.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T52921
|
||||
UniProt ID | |||||
Sequence |
MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC KTSETVPRPA |
||||
Drugs and Mode of Action | |||||
Inhibitor | 1-(1,2-diphenylethyl)-4-phenylpiperidin-4-ol | Drug Info | [528785] | ||
1-(2-ethoxy-1-phenylethyl)-4-phenylpiperidin-4-ol | Drug Info | [528785] | |||
1-(3,3-diphenylpropyl)-4-phenylpiperidin-4-ol | Drug Info | [528785] | |||
1-(dio-tolylmethyl)-4-phenylpiperidin-4-ol | Drug Info | [528785] | |||
1-benzhydryl-4-(2-fluorophenyl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(2-methoxyphenyl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(3-fluorophenyl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(3-methoxyphenyl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(3-phenylpropyl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(4-bromophenyl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(4-butylphenyl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(4-chlorophenyl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(4-ethylphenyl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(4-fluorophenyl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(4-methoxyphenyl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(4-propylphenyl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(benzyloxy)-4-phenylpiperidine | Drug Info | [528785] | |||
1-benzhydryl-4-(furan-2-yl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(pyridin-2-yl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-(thiophen-2-yl)piperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-benzylpiperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-butylpiperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-cyclohexylpiperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-cyclopropylpiperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-ethoxy-4-phenylpiperidine | Drug Info | [528785] | |||
1-benzhydryl-4-hexylpiperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-isopropylpiperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-m-tolylpiperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-methoxy-4-phenylpiperidine | Drug Info | [528785] | |||
1-benzhydryl-4-o-tolylpiperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-p-tolylpiperidin-4-ol | Drug Info | [528781] | |||
1-benzhydryl-4-phenyl-4-propoxypiperidine | Drug Info | [528785] | |||
1-benzhydryl-4-phenylpiperidin-4-ol | Drug Info | [530052] | |||
1-benzhydryl-4-tert-butylpiperidin-4-ol | Drug Info | [528781] | |||
1-benzyl-4-phenylpiperidin-4-ol | Drug Info | [528785] | |||
2,2-diMeBut-RYYRIK-NH2 | Drug Info | [529208] | |||
2-MePen-RYYRIK-NH2 | Drug Info | [529208] | |||
3-(1-benzylpiperidin-4-yl)-5-chloro-1H-indole | Drug Info | [528151] | |||
4-(2-(aminomethyl)phenyl)-1-benzylpiperidin-4-ol | Drug Info | [528781] | |||
4-phenyl-1-(1-phenylbutyl)piperidin-4-ol | Drug Info | [528785] | |||
4-phenyl-1-(1-phenylethyl)piperidin-4-ol | Drug Info | [528785] | |||
4-phenyl-1-(1-phenylheptyl)piperidin-4-ol | Drug Info | [528785] | |||
4-phenyl-1-(1-phenylhexyl)piperidin-4-ol | Drug Info | [528785] | |||
4-phenyl-1-(1-phenylpentyl)piperidin-4-ol | Drug Info | [528785] | |||
4-phenyl-1-(1-phenylpropan-2-yl)piperidin-4-ol | Drug Info | [528785] | |||
4-phenyl-1-(1-phenylpropyl)piperidin-4-ol | Drug Info | [528785] | |||
4-phenyl-1-(3-phenylpropyl)piperidin-4-ol | Drug Info | [528785] | |||
4-phenyl-1-(phenyl(m-tolyl)methyl)piperidin-4-ol | Drug Info | [528785] | |||
4-phenyl-1-(phenyl(o-tolyl)methyl)piperidin-4-ol | Drug Info | [528785] | |||
4-phenyl-1-(phenyl(p-tolyl)methyl)piperidin-4-ol | Drug Info | [528785] | |||
Ac-Phe-[Orn-Pro-cha-Trp-Arg] | Drug Info | [528343] | |||
Ac-RYYRIK-GGG-K-(NH2)-YAFGYPS-GG | Drug Info | [528282] | |||
Ac-RYYRIK-GGG-K-(NH2)-YRFB-GGGGG | Drug Info | [528282] | |||
Ac-RYYRIK-K-(NH2)-YAFGYPS | Drug Info | [528282] | |||
Ac-RYYRIK-K-(NH2)-YRFB | Drug Info | [528282] | |||
Ac-RYYRIK-NH2 | Drug Info | [528282] | |||
Ada-RYYRIK-NH2 | Drug Info | [529208] | |||
Bu-RYYRIK-NH2 | Drug Info | [529208] | |||
Bz--RYYRIK-NH2 | Drug Info | [529208] | |||
CFGGFTCARKSARK | Drug Info | [526185] | |||
CFGGFTGARKCARK | Drug Info | [526185] | |||
Cyclo-[Asp6,Lys10]N/OFQ(1-13)NH2 | Drug Info | [529593] | |||
Cyclo[Cys6,Cys10]N/OFQ(1-13)NH2 | Drug Info | [529593] | |||
Cyclo[Cys7,Cys10]N/OFQ(1-13)NH2 | Drug Info | [529593] | |||
Cyclo[DAsp7,Lys10]N/OFQ(1-13)NH2 | Drug Info | [529593] | |||
EtBut-RYYRIK-NH2 | Drug Info | [529208] | |||
F-G-G-F-T-G-A-R-K-S-A-R-K-L-Aib-N-Q-CONH2 | Drug Info | [526456] | |||
F-G-G-F-T-G-A-R-K-S-A-R-K-L-Aib-N-Q-COOH | Drug Info | [526456] | |||
F-G-G-F-T-G-A-R-K-S-A-R-K-L-MeA-N-Q-CONH2 | Drug Info | [526456] | |||
F-G-G-F-T-G-A-R-K-S-A-R-K-L-MeA-N-Q-COOH | Drug Info | [526456] | |||
F-G-G-F-T-G-A-R-K-S-Aib-R-K-L-A-N-Q-CONH2 | Drug Info | [526456] | |||
F-G-G-F-T-G-A-R-K-S-Aib-R-K-L-A-N-Q-COOH | Drug Info | [526456] | |||
F-G-G-F-T-G-A-R-K-S-MeA-R-K-L-A-N-Q-CONH2 | Drug Info | [526456] | |||
F-G-G-F-T-G-A-R-K-S-MeA-R-K-L-A-N-Q-COOH | Drug Info | [526456] | |||
F-G-G-F-T-G-Aib-R-K-S-A-R-K-L-A-N-Q-CONH2 | Drug Info | [526456] | |||
F-G-G-F-T-G-Aib-R-K-S-A-R-K-L-A-N-Q-COOH | Drug Info | [526456] | |||
F-G-G-F-T-G-Aib-R-K-S-Aib-R-K-L-A-N-Q-CONH2 | Drug Info | [526456] | |||
F-G-G-F-T-G-MeA-R-K-S-A-R-K-L-A-N-Q-CONH2 | Drug Info | [526456] | |||
F-G-G-F-T-G-MeA-R-K-S-A-R-K-L-A-N-Q-COOH | Drug Info | [526456] | |||
FGGFTCARKCARK | Drug Info | [526185] | |||
FGGFTGARKCARKC | Drug Info | [526185] | |||
FGGFTGARKRKRKLANQ | Drug Info | [529719] | |||
FGGFTGARKSARK | Drug Info | [526185] | |||
FGGFTGARKSARKAANQ | Drug Info | [529719] | |||
FGGFTGARKSARKFANQ | Drug Info | [529719] | |||
FGGFTGARKSARKKANQ | Drug Info | [529719] | |||
FGGFTGARKSARKKKNQ | Drug Info | [529719] | |||
FGGFTGARKSARKKRNQ | Drug Info | [529719] | |||
FGGFTGARKSARKKWNQ | Drug Info | [530249] | |||
FGGFTGARKSARKL | Drug Info | [526185] | |||
FGGFTGARKSARKLADE | Drug Info | [526185] | |||
FGGFTGARKSARKLARK | Drug Info | [529719] | |||
FGGFTGARKSARKLFNQ | Drug Info | [529719] | |||
FGGFTGARKSARKLKNQ | Drug Info | [529719] | |||
FGGFTGARKSARKLLNQ | Drug Info | [529719] | |||
FGGFTGARKSARKLRNQ | Drug Info | [529719] | |||
FGGFTGARKSARKLVNQ | Drug Info | [529719] | |||
FGGFTGARKSARKLWNQ | Drug Info | [530249] | |||
FGGFTGARKSARKLYNQ | Drug Info | [529719] | |||
FGGFTGARKSARKRANQ | Drug Info | [529719] | |||
FGGFTGARKSARKRKNQ | Drug Info | [530249] | |||
FGGFTGARKSARKRKRK | Drug Info | [529719] | |||
FGGFTGARKSARKRRNQ | Drug Info | [529719] | |||
FGGFTGARKSARKRWNQ | Drug Info | [530249] | |||
FGGFTGARKSARKVANQ | Drug Info | [529719] | |||
FGGFTGARKSARKWANQ | Drug Info | [530249] | |||
FGGFTGARKSARKWKNQ | Drug Info | [530249] | |||
FGGFTGARKSARKWRNQ | Drug Info | [530249] | |||
FGGFTGARKSARKYANQ | Drug Info | [529719] | |||
FGGFTGCRKSARKC | Drug Info | [526185] | |||
FGGFTGCRKSCRK | Drug Info | [526185] | |||
FGGFTRKRKSARKLANQ | Drug Info | [529719] | |||
FLUPERAMIDE | Drug Info | [527228] | |||
For-RYYRIK-NH2 | Drug Info | [529208] | |||
H-RYYRIK-NH2 | Drug Info | [529208] | |||
Hex-RYYRIK-NH2 | Drug Info | [529208] | |||
IsoBu-RYYRIK-NH2 | Drug Info | [529208] | |||
IsoVa-RYYRIK-NH2 | Drug Info | [529208] | |||
MeBut-RYYRIK-NH2 | Drug Info | [529208] | |||
NOCICEPTIN | Drug Info | [529719] | |||
Piv-RYYRIK-NH2 | Drug Info | [529208] | |||
Pr-RYYRIK-NH2 | Drug Info | [529208] | |||
T-BuAc-RYYRIK-NH2 | Drug Info | [529208] | |||
Va-RYYRIK-NH2 | Drug Info | [529208] | |||
[Asp6,Lys10]N/OFQ(1-13)NH2 | Drug Info | [529593] | |||
[D-Asp7,Lys10]N/OFQ(1-13)NH2 | Drug Info | [529593] | |||
Antagonist | Banyu Compound-24 | Drug Info | [530141] | ||
BND-001 | Drug Info | [543766] | |||
J-113397 | Drug Info | [535360], [535745], [536893] | |||
JTC-801 | Drug Info | [537331] | |||
peptide III-BTD | Drug Info | [525587] | |||
PF-454583 | Drug Info | [543766] | |||
SB-612111 | Drug Info | [543766] | |||
UFP-101 | Drug Info | [526331] | |||
[Nphe(1)]-nociceptin (1-13)-NH(2) | Drug Info | [535360] | |||
Modulator | LY-2940094 | Drug Info | [551571], [551633] | ||
Agonist | N/OFQ-(1-13)-NH2 | Drug Info | [534406] | ||
nociceptin/orphanin FQ | Drug Info | [534499] | |||
Ro-64-6198 | Drug Info | [535745] | |||
SCH-221510 | Drug Info | [543766] | |||
SER-100 | Drug Info | [551680] | |||
Syn-1020 | Drug Info | [543766] | |||
UFP-112 | Drug Info | [529945] | |||
Binder | Nociceptin/orphanin FQ receptor PET ligands | Drug Info | [543766] | ||
SR-14136 | Drug Info | [543766] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
Reactome | Peptide ligand-binding receptors | ||||
G alpha (i) signalling events | |||||
WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
Peptide GPCRs | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 521792 | ClinicalTrials.gov (NCT00283361) ZP120 Add-on to Furosemide in Treatment of Acute or Sub-Acute Decompensated Heart Failure. U.S. National Institutes of Health. | ||||
Ref 523563 | ClinicalTrials.gov (NCT01404091) A Study of Nociceptin/Orphanin FQ Peptide Receptor Occupancy in Healthy Subjects. U.S. National Institutes of Health. | ||||
Ref 524117 | ClinicalTrials.gov (NCT01724112) Study of the Efficacy and Safety of LY2940094 in Participants With Major Depressive Disorder (MDD). U.S. National Institutes of Health. | ||||
Ref 525587 | Ligands for kappa-opioid and ORL1 receptors identified from a conformationally constrained peptide combinatorial library. J Biol Chem. 1999 Sep 24;274(39):27513-22. | ||||
Ref 526185 | J Med Chem. 2001 Nov 8;44(23):4015-8.Structure-activity studies on nociceptin analogues: ORL1 receptor binding and biological activity of cyclic disulfide-containing analogues of nociceptin peptides. | ||||
Ref 526331 | Nphe1,Arg14,Lys15nociceptin-NH2, a novel potent and selective antagonist of the nociceptin/orphanin FQ receptor. Br J Pharmacol. 2002 May;136(2):303-11. | ||||
Ref 526456 | J Med Chem. 2002 Nov 21;45(24):5280-6.Novel, potent ORL-1 receptor agonist peptides containing alpha-Helix-promoting conformational constraints. | ||||
Ref 527228 | Bioorg Med Chem Lett. 2004 Nov 1;14(21):5275-9.Design and synthesis of 4-phenyl piperidine compounds targeting the mu receptor. | ||||
Ref 528151 | Bioorg Med Chem Lett. 2006 Jul 1;16(13):3524-8. Epub 2006 Apr 24.3-(4-Piperidinyl)indoles and 3-(4-piperidinyl)pyrrolo-[2,3-b]pyridines as ligands for the ORL-1 receptor. | ||||
Ref 528282 | Bioorg Med Chem Lett. 2006 Sep 15;16(18):4839-41. Epub 2006 Jun 30.Synthesis and receptor binding properties of chimeric peptides containing a mu-opioid receptor ligand and nociceptin/orphanin FQ receptor ligand Ac-RYYRIK-amide. | ||||
Ref 528343 | Bioorg Med Chem Lett. 2006 Oct 1;16(19):5088-92. Epub 2006 Jul 28.Peptidomimetic C5a receptor antagonists with hydrophobic substitutions at the C-terminus: increased receptor specificity and in vivoactivity. | ||||
Ref 528781 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3028-33. Epub 2007 Mar 21.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 2. | ||||
Ref 528785 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3023-7. Epub 2007 Mar 23.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 1. | ||||
Ref 529208 | Bioorg Med Chem. 2008 Mar 1;16(5):2635-44. Epub 2007 Nov 21.Designed modification of partial agonist of ORL1 nociceptin receptor for conversion into highly potent antagonist. | ||||
Ref 529593 | J Med Chem. 2008 Aug 14;51(15):4385-7. Epub 2008 Jul 15.High affinity conformationally constrained nociceptin/orphanin FQ(1-13) amide analogues. | ||||
Ref 529719 | Bioorg Med Chem. 2008 Oct 15;16(20):9261-7. Epub 2008 Sep 9.Synergistic effect of basic residues at positions 14-15 of nociceptin on binding affinity and receptor activation. | ||||
Ref 529945 | Pharmacological profile of NOP receptors coupled with calcium signaling via the chimeric protein G alpha qi5. Naunyn Schmiedebergs Arch Pharmacol. 2009 Jun;379(6):599-607. | ||||
Ref 530052 | Bioorg Med Chem Lett. 2009 May 1;19(9):2519-23. Epub 2009 Mar 14.The discovery of tropane derivatives as nociceptin receptor ligands for the management of cough and anxiety. | ||||
Ref 530141 | Pharmacological characterization of the nociceptin/orphanin FQ receptor non peptide antagonist Compound 24. Eur J Pharmacol. 2009 Jul 1;614(1-3):50-7. | ||||
Ref 530249 | Bioorg Med Chem. 2009 Aug 1;17(15):5683-7. Epub 2009 Jun 13.Discriminatory synergistic effect of Trp-substitutions in superagonist [(Arg/Lys)(14), (Arg/Lys)(15)]nociceptin on ORL1 receptor binding and activation. | ||||
Ref 534406 | Address and message sequences for the nociceptin receptor: a structure-activity study of nociceptin-(1-13)-peptide amide. J Med Chem. 1997 Jun 6;40(12):1789-93. | ||||
Ref 534499 | Binding and in vitro activities of peptides with high affinity for the nociceptin/orphanin FQ receptor, ORL1. J Pharmacol Exp Ther. 1997 Nov;283(2):735-41. | ||||
Ref 535360 | Nociceptin receptor antagonists display antidepressant-like properties in the mouse forced swimming test. Naunyn Schmiedebergs Arch Pharmacol. 2002 Feb;365(2):164-7. Epub 2001 Dec 20. | ||||
Ref 535745 | The nociceptin receptor as a potential target in drug design. Drug News Perspect. 2001 Aug;14(6):335-45. | ||||
Ref 536893 | Nocistatin and nociceptin given centrally induce opioid-mediated gastric mucosal protection. Peptides. 2008 Dec;29(12):2257-65. Epub 2008 Sep 26. | ||||
Ref 537331 | Nociceptin receptor antagonist JTC-801 inhibits nitrous oxide-induced analgesia in mice. J Anesth. 2009;23(2):301-3. Epub 2009 May 15. | ||||
Ref 543766 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 320). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.