Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T31518 | Target Info | |||
Target Name | Apolipoprotein C-III (ApoCIII) | ||||
Synonyms | Apolipoprotein CIII; Apolipoprotein C3; ApoC-III; Apo-CIII | ||||
Target Type | Clinical trial Target | ||||
Gene Name | APOC3 | ||||
Biochemical Class | Apolipoprotein | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | Hepatocyte nuclear factor 4-alpha (HNF-4A) homodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Hepatocyte nuclear factor 4 | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | The region of theAPOC3promoterresponsible for the regulation is mapped in transiently transfected HepG2 cells to a 6-base pair element located at -740. The major protein binding to this site is identified as theHNF4. | [1] | |||
Evidence Score (E-score) | 4 | + | |||
UniProt ID | |||||
Sequence |
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
Nuclear hormone receptors | [+] 1 Nuclear hormone receptors Co-regulated By This TF | + | |||
Oxidoreductases | [+] 2 Oxidoreductases Co-regulated By This TF | + | |||
Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
Serpin proteins | [+] 1 Serpin proteins Co-regulated By This TF | + | |||
Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
TF Name | COUP transcription factor 1 (COUP-TF1) homodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Regulation Type | Decrease | ||||
Regulation Mechanism | The transcription factor COUP-TF1 acts at the C3P site (a cis-acting regulatory element, C3P, located at -90 to -66 upstream from the apoCIII gene transcriptional start site (+1)). | [2] | |||
Evidence Score (E-score) | 3 | + | |||
UniProt ID | |||||
Sequence |
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGA
PATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTY TCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLN GHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF PDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIR IFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQY PNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSI QCS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
TF Name | Retinoid X receptor alpha (RXR-A) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Retinoid X receptors | ||||
Evidence Score (E-score) | 2 | + | |||
UniProt ID | |||||
Sequence |
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Acyltransferases | [+] 1 Acyltransferases Co-regulated By This TF | + | |||
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
Ester hydrolases | [+] 1 Ester hydrolases Co-regulated By This TF | + | |||
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
Glycoproteins | [+] 2 Glycoproteins Co-regulated By This TF | + | |||
Kinases | [+] 1 Kinases Co-regulated By This TF | + | |||
Mitochondrial carriers | [+] 1 Mitochondrial carriers Co-regulated By This TF | + | |||
Nuclear hormone receptors | [+] 4 Nuclear hormone receptors Co-regulated By This TF | + | |||
TF Name | COUP transcription factor 2 (COUP-TF2) homodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Regulation Type | Decrease | ||||
Regulation Mechanism | The transcription factor COUP-TF2 acts at the C3P site (a cis-acting regulatory element, C3P, located at -90 to -66 upstream from the apoCIII gene transcriptional start site (+1)). | [2] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
Glycoproteins | [+] 1 Glycoproteins Co-regulated By This TF | + | |||
Nuclear hormone receptors | [+] 1 Nuclear hormone receptors Co-regulated By This TF | + | |||
TF Name | Retinoic acid receptor alpha (RAR-A) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Retinoic acid receptors | ||||
Regulation Mechanism | The proximal element B (-87/-72) binds strongly, in addition to HNF-4, ARP-1, EAR-2, and EAR-3, heterodimers of RXR-A withRAR-A, and less efficiently, homodimers ofRAR-Aand heterodimers of RXR-A with T3Rbeta orPPA-A. | [4] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 2 Apolipoproteins Co-regulated By This TF | + | |||
Growth factors | [+] 1 Growth factors Co-regulated By This TF | + | |||
Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
Mitochondrial carriers | [+] 1 Mitochondrial carriers Co-regulated By This TF | + | |||
Nuclear hormone receptors | [+] 3 Nuclear hormone receptors Co-regulated By This TF | + | |||
TF Name | NF-kappa-B p50-p50 (NFKB) homodimer | ||||
Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
Class | RHR (Rel homology region) | ||||
Family | Rel/ankyrin | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Analysis of the full length APOC3 promoter demonstrated that the inducible activity of the NFKB element was suppressed by sequences in the APOC3 enhancer element located approximately 500 nucleotides upstream of the NFKB binding site. | [5] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ EGPLEGKI |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
Apoptosis regulators | [+] 1 Apoptosis regulators Co-regulated By This TF | + | |||
CD antigens | [+] 1 CD antigens Co-regulated By This TF | + | |||
Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + | |||
TF Name | NF-kappa-B p65-p65 (NFKB) homodimer | ||||
Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
Class | RHR (Rel homology region) | ||||
Family | Rel/ankyrin | ||||
Regulation Mechanism | Analysis of the full length APOC3 promoter demonstrated that the inducible activity of the NFKB element was suppressed by sequences in the APOC3 enhancer element located approximately 500 nucleotides upstream of the NFKB binding site. | [5] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM DFSALLSQISS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
Cytokines / Cytokine receptors | [+] 3 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
Transcription factors | [+] 2 Transcription factors Co-regulated By This TF | + | |||
TF Name | Peroxisome proliferator-activated receptor alpha (PPAR-A) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Thyroid hormone receptors | ||||
Regulation Mechanism | PPAR-A binds and modulates the human APOC3 promoter activity. | [4] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Acyltransferases | [+] 1 Acyltransferases Co-regulated By This TF | + | |||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
TF Name | Upstream stimulatory factor 1 (USF1) homodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Helix-loop-helix / leucine zipper factors (bHLH-ZIP) | ||||
Family | Upstream stimulatory factor | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Ubiquitously expressed USF binds to the proximal (-87/-72) element B of the human APOC3 (-890/+24) promoter. | [6] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP STAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAP RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG LEVVIKNDSN |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
Cyclins | [+] 1 Cyclins Co-regulated By This TF | + | |||
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
Serpin proteins | [+] 1 Serpin proteins Co-regulated By This TF | + | |||
TF Name | Upstream stimulatory factor 2 (USF2) homodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Helix-loop-helix / leucine zipper factors (bHLH-ZIP) | ||||
Family | Upstream stimulatory factor | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Ubiquitously expressed USF binds to the proximal (-87/-72) element B of the human APOC3 (-890/+24) promoter. | [6] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFG
DHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVD GAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTA VSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQH NEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQET FKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 2 Apolipoproteins Co-regulated By This TF | + | |||
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Mitogen-activated protein kinase regulates transcription of the ApoCIII gene. Involvement of the orphan nuclear receptor HNF4. J Biol Chem. 1999 Nov 12;274(46):33050-6. | ||||
REF 2 | Antagonism between apolipoprotein AI regulatory protein 1, Ear3/COUP-TF, and hepatocyte nuclear factor 4 modulates apolipoprotein CIII gene expression in liver and intestinal cells. Mol Cell Biol. 1992 Apr;12(4):1708-18. | ||||
REF 3 | Mode of action of peroxisome proliferators as hypolipidemic drugs. Suppression of apolipoprotein C-III. J Biol Chem. 1995 Jun 2;270(22):13470-5. | ||||
REF 4 | Binding specificity and modulation of the human ApoCIII promoter activity by heterodimers of ligand-dependent nuclear receptors. Biochemistry. 1999 Jan 19;38(3):964-75. | ||||
REF 5 | Apo CIII gene transcription is regulated by a cytokine inducible NF-kappa B element. Nucleic Acids Res. 1994 Jun 25;22(12):2417-22. | ||||
REF 6 | Two initiator-like elements are required for the combined activation of the human apolipoprotein C-III promoter by upstream stimulatory factor and ... J Biol Chem. 2002 Apr 26;277(17):15199-206. | ||||
REF 7 | Liver-enriched transcription factor HNF-4 is a novel member of the steroid hormone receptor superfamily. Genes Dev. 1990 Dec;4(12B):2353-65. | ||||
REF 8 | An indirect negative autoregulatory mechanism involved in hepatocyte nuclear factor-1 gene expression. Nucleic Acids Res. 1993 Dec 25;21(25):5882-9. | ||||
REF 9 | Transcriptional regulation of human apolipoprotein genes ApoB, ApoCIII, and ApoAII by members of the steroid hormone receptor superfamily HNF-4, AR... J Biol Chem. 1992 Aug 5;267(22):15849-60. | ||||
REF 10 | Modulation of transcriptional activation and coactivator interaction by a splicing variation in the F domain of nuclear receptor hepatocyte nuclear factor 4alpha1. Mol Cell Biol. 1999 Oct;19(10):6509-22. | ||||
REF 11 | Identification and characterization of a 315-base pair enhancer, located more than 55 kilobases 5' of the apolipoprotein B gene, that confers expression in the intestine. J Biol Chem. 2000 Aug 25;275(34):26637-48. | ||||
REF 12 | cis-acting elements and transcription factors involved in the promoter activity of the human factor VIII gene. J Biol Chem. 1995 May 19;270(20):11828-38. | ||||
REF 13 | The orphan receptor hepatic nuclear factor 4 functions as a transcriptional activator for tissue-specific and hypoxia-specific erythropoietin gene expression and is antagonized by EAR3/COUP-TF1. Mol Cell Biol. 1995 Apr;15(4):2135-44. | ||||
REF 14 | Regulatory mechanisms controlling human hepatocyte nuclear factor 4alpha gene expression. Mol Cell Biol. 2001 Nov;21(21):7320-30. | ||||
REF 15 | Characterization of the human cytochrome P4502D6 promoter. A potential role for antagonistic interactions between members of the nuclear receptor family. J Biol Chem. 1996 Oct 11;271(41):25269-76. | ||||
REF 16 | Co-operation of the transcription factor hepatocyte nuclear factor-4 with Sp1 or Sp3 leads to transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line. Biochem J. 2002 Nov 1;367(Pt 3):641-52. | ||||
REF 17 | Disruption of a C/EBP binding site in the factor IX promoter is associated with haemophilia B. Nature. 1990 May 31;345(6274):444-6. | ||||
REF 18 | Regulated expression of human angiotensinogen gene by hepatocyte nuclear factor 4 and chicken ovalbumin upstream promoter-transcription factor. J Biol Chem. 1999 Dec 3;274(49):34605-12. | ||||
REF 19 | A different combination of transcription factors modulates the expression of the human transferrin promoter in liver and Sertoli cells. J Biol Chem. 1993 Nov 5;268(31):23399-408. | ||||
REF 20 | COUP orphan receptors are negative regulators of retinoic acid response pathways. Mol Cell Biol. 1992 Oct;12(10):4666-76. | ||||
REF 21 | Transcriptional regulation of the apolipoprotein B100 gene: purification and characterization of trans-acting factor BRF-2. Mol Cell Biol. 1992 Jul;12(7):3183-91. | ||||
REF 22 | Co-regulation of tissue-specific alternative human carnitine palmitoyltransferase Ibeta gene promoters by fatty acid enzyme substrate. J Biol Chem. 1998 Dec 4;273(49):32901-9. | ||||
REF 23 | Bile acid-activated nuclear receptor FXR suppresses apolipoprotein A-I transcription via a negative FXR response element. J Clin Invest. 2002 Apr;109(7):961-71. | ||||
REF 24 | Retinoids increase human apolipoprotein A-11 expression through activation of the retinoid X receptor but not the retinoic acid receptor. Mol Cell Biol. 1996 Jul;16(7):3350-60. | ||||
REF 25 | LXRs control lipid-inducible expression of the apolipoprotein E gene in macrophages and adipocytes. Proc Natl Acad Sci U S A. 2001 Jan 16;98(2):507-12. | ||||
REF 26 | PPARalpha and PPARgamma activators direct a distinct tissue-specific transcriptional response via a PPRE in the lipoprotein lipase gene. EMBO J. 1996 Oct 1;15(19):5336-48. | ||||
REF 27 | Human calcium-sensing receptor gene. Vitamin D response elements in promoters P1 and P2 confer transcriptional responsiveness to 1,25-dihydroxyvitamin D. J Biol Chem. 2002 Aug 16;277(33):30337-50. | ||||
REF 28 | The orphan nuclear receptor LRH-1 potentiates the sterol-mediated induction of the human CETP gene by liver X receptor. J Biol Chem. 2001 Jul 6;276(27):24767-73. | ||||
REF 29 | The farnesoid X-activated receptor mediates bile acid activation of phospholipid transfer protein gene expression. J Biol Chem. 2000 Dec 15;275(50):39313-7. | ||||
REF 30 | T3 receptor suppression of Sp1-dependent transcription from the epidermal growth factor receptor promoter via overlapping DNA-binding sites. J Biol Chem. 1993 Jul 25;268(21):16065-73. | ||||
REF 31 | The human uncoupling protein-3 gene promoter requires MyoD and is induced by retinoic acid in muscle cells. FASEB J. 2000 Nov;14(14):2141-3. | ||||
REF 32 | Vitamin D represses retinoic acid-dependent transactivation of the retinoic acid receptor-beta2 promoter: the AF-2 domain of the vitamin D receptor is required for transrepression. Endocrinology. 1999 Jun;140(6):2898-907. | ||||
REF 33 | RAR gamma 2 expression is regulated through a retinoic acid response element embedded in Sp1 sites. Mol Cell Biol. 1992 Jul;12(7):2976-85. | ||||
REF 34 | Identification of thyroid hormone response elements in the human fatty acid synthase promoter. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12260-5. | ||||
REF 35 | Intestinal apolipoprotein AI gene transcription is regulated by multiple distinct DNA elements and is synergistically activated by the orphan nuclear receptor, hepatocyte nuclear factor 4. J Clin Invest. 1995 Jul;96(1):528-38. | ||||
REF 36 | Transcriptional regulation of the cholesteryl ester transfer protein gene by the orphan nuclear hormone receptor apolipoprotein AI regulatory protein-1. J Biol Chem. 1995 Dec 15;270(50):29916-22. | ||||
REF 37 | Differential transcriptional regulation of the apoAI gene by retinoic acid receptor homo- and heterodimers in yeast. Nucleic Acids Res. 1996 Feb 15;24(4):566-72. | ||||
REF 38 | Acceleration of thrombomodulin gene transcription by retinoic acid: retinoic acid receptors and Sp1 regulate the promoter activity through interactions with two different sequences in the 5'-flanking region of human gene. J Biol Chem. 2001 Jan 26;276(4):2440-50. | ||||
REF 39 | Identification and characterization of a functional retinoic acid/thyroid hormone-response element upstream of the human insulin gene enhancer. Biochem J. 1995 Aug 1;309 ( Pt 3):863-70. | ||||
REF 40 | Heterodimeric retinoic acid receptor-beta and retinoid X receptor-alpha complexes stimulate expression of the intercellular adhesion molecule-1 gene. Cell Growth Differ. 1995 May;6(5):515-21. | ||||
REF 41 | Identification of a retinoic acid responsive element in the retinoic acid receptor beta gene. Nature. 1990 Jan 11;343(6254):177-80. | ||||
REF 42 | NF-kappaB1 (p50) homodimers contribute to transcription of the bcl-2 oncogene. J Biol Chem. 2001 Nov 30;276(48):45380-6. | ||||
REF 43 | Endothelial interferon regulatory factor 1 cooperates with NF-kappa B as a transcriptional activator of vascular cell adhesion molecule 1. Mol Cell Biol. 1995 May;15(5):2558-69. | ||||
REF 44 | Characterization of a functional NF-kappa B site in the human interleukin 1 beta promoter: evidence for a positive autoregulatory loop. Mol Cell Biol. 1993 Oct;13(10):6231-40. | ||||
REF 45 | Inhibition of IL-12 production by 1,25-dihydroxyvitamin D3. Involvement of NF-kappaB downregulation in transcriptional repression of the p40 gene. J Clin Invest. 1998 Jan 1;101(1):252-62. | ||||
REF 46 | Flanking sequences for the human intercellular adhesion molecule-1 NF-kappaB response element are necessary for tumor necrosis factor alpha-induced gene expression. J Biol Chem. 1997 Jun 20;272(25):15928-35. | ||||
REF 47 | The transcriptional regulation of human arachidonate 12-lipoxygenase gene by NF kappa B/Rel. FEBS Lett. 1995 Apr 17;363(1-2):105-10. | ||||
REF 48 | Expression of human p53 requires synergistic activation of transcription from the p53 promoter by AP-1, NF-kappaB and Myc/Max. Oncogene. 1999 Apr 29;18(17):2728-38. | ||||
REF 49 | Inhibition of NF-AT-dependent transcription by NF-kappa B: implications for differential gene expression in T helper cell subsets. Proc Natl Acad Sci U S A. 1995 Dec 5;92(25):11623-7. | ||||
REF 50 | Synergy between interferon-gamma and tumor necrosis factor-alpha in transcriptional activation is mediated by cooperation between signal transducer and activator of transcription 1 and nuclear factor kappaB. J Biol Chem. 1997 Jun 6;272(23):14899-907. | ||||
REF 51 | Upstream stimulatory factor regulates expression of the cell cycle-dependent cyclin B1 gene promoter. Mol Cell Biol. 1995 May;15(5):2782-90. | ||||
REF 52 | Interaction of upstream stimulatory factor with the human heme oxygenase gene promoter. Eur J Biochem. 1990 Mar 10;188(2):231-7. | ||||
REF 53 | Molecular variation of the human angiotensinogen core promoter element located between the TATA box and transcription initiation site affects its transcriptional activity. J Biol Chem. 1997 Nov 28;272(48):30558-62. | ||||
REF 54 | Cooperative binding of upstream stimulatory factor and hepatic nuclear factor 4 drives the transcription of the human apolipoprotein A-II gene. J Biol Chem. 1999 Jan 15;274(3):1216-25. | ||||
REF 55 | USF/c-Myc enhances, while Yin-Yang 1 suppresses, the promoter activity of CXCR4, a coreceptor for HIV-1 entry. J Immunol. 1999 May 15;162(10):5986-92. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.