Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T80896
(Former ID: TTDS00250)
|
|||||
Target Name |
Estrogen receptor beta (ESR2)
|
|||||
Synonyms |
Oestrogen receptor beta; Nuclear receptor subfamily 3 group A member 2; NR3A2; Erbeta; ESTRB; ER-beta; Beta-1
|
|||||
Gene Name |
ESR2
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 4 Target-related Diseases | + | ||||
1 | Breast cancer [ICD-11: 2C60-2C6Y] | |||||
2 | Cushing syndrome [ICD-11: 5A70] | |||||
3 | Menopausal disorder [ICD-11: GA30] | |||||
4 | Vasomotor/allergic rhinitis [ICD-11: CA08] | |||||
Function |
Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual. Nuclear hormone receptor.
Click to Show/Hide
|
|||||
BioChemical Class |
Nuclear hormone receptor
|
|||||
UniProt ID | ||||||
Sequence |
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T05O6O |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 4 Approved Drugs | + | ||||
1 | ARZOXIFENE | Drug Info | Approved | Breast cancer | [2], [3] | |
2 | Conjugated Estrogens | Drug Info | Approved | Menopause symptom | [4] | |
3 | Estrogen | Drug Info | Approved | Menopause symptom | [5] | |
4 | Trilostane | Drug Info | Approved | Cushing disease | [6], [7] | |
Clinical Trial Drug(s) | [+] 8 Clinical Trial Drugs | + | ||||
1 | MF-101 | Drug Info | Phase 3 | Hepatitis virus infection | [8] | |
2 | Premarin/Pravachol | Drug Info | Phase 3 | Hyperlipidaemia | [9] | |
3 | Genistein | Drug Info | Phase 2/3 | Menopause symptom | [10] | |
4 | AUS-131 | Drug Info | Phase 2 | Hot flushes | [11] | |
5 | ERB-041 | Drug Info | Phase 2 | Inflammatory bowel disease | [12], [13] | |
6 | Erteberel | Drug Info | Phase 2 | Prostate hyperplasia | [14] | |
7 | VG-101 | Drug Info | Phase 1/2 | Menopause symptom | [15] | |
8 | ERB-257 | Drug Info | Phase 1 | Sepsis | [16] | |
Discontinued Drug(s) | [+] 8 Discontinued Drugs | + | ||||
1 | BITHIONOL | Drug Info | Withdrawn from market | Trematode infection | [5], [17] | |
2 | HEXESTROL | Drug Info | Withdrawn from market | Irregularities | [18], [19], [20] | |
3 | EM-800 | Drug Info | Discontinued in Phase 3 | Estrogen deficiency | [21] | |
4 | ERA-923 | Drug Info | Discontinued in Phase 2 | Breast cancer | [22] | |
5 | ERB-196 | Drug Info | Discontinued in Phase 1 | Inflammatory bowel disease | [23] | |
6 | HE2100 | Drug Info | Discontinued in Phase 1 | Thrombocytopenia | [24] | |
7 | ICI-164384 | Drug Info | Terminated | Breast cancer | [25] | |
8 | ZK-119010 | Drug Info | Terminated | Carcinoma | [26] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Inhibitor | [+] 158 Inhibitor drugs | + | ||||
1 | ARZOXIFENE | Drug Info | [27] | |||
2 | NARINGENIN | Drug Info | [38] | |||
3 | BITHIONOL | Drug Info | [39] | |||
4 | HEXESTROL | Drug Info | [40] | |||
5 | ERA-923 | Drug Info | [42] | |||
6 | HE2100 | Drug Info | [44] | |||
7 | ICI-164384 | Drug Info | [45] | |||
8 | LY-117018 | Drug Info | [46] | |||
9 | ZK-119010 | Drug Info | [47] | |||
10 | 1,2-Bis-(4-hydroxy-phenyl)-3H-inden-5-ol | Drug Info | [48] | |||
11 | 1,8-Dichloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
12 | 1-Bromo-6-(4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
13 | 1-CHLORO-6-(4-HYDROXYPHENYL)-2-NAPHTHOL | Drug Info | [49], [50] | |||
14 | 1-Fluoro-6-(4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
15 | 2,3-diphenyl-1H-indole | Drug Info | [51] | |||
16 | 2-(2-Chloro-4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [52] | |||
17 | 2-(3-Butoxy-4-hydroxy-phenyl)-benzooxazol-6-ol | Drug Info | [52] | |||
18 | 2-(3-Chloro-4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [52] | |||
19 | 2-(3-Chloro-4-hydroxy-phenyl)-benzooxazol-6-ol | Drug Info | [52] | |||
20 | 2-(3-Fluoro-4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [52] | |||
21 | 2-(3-Fluoro-4-hydroxy-phenyl)-benzooxazol-6-ol | Drug Info | [52] | |||
22 | 2-(3-hydroxyphenyl)-1,2'-spirobi[1H-indene]-5-ol | Drug Info | [53] | |||
23 | 2-(3-hydroxyphenyl)-1,2'-spirobi[1H-indene]-6-ol | Drug Info | [53] | |||
24 | 2-(4-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol | Drug Info | [52] | |||
25 | 2-(4-Hydroxy-phenyl)-1-p-tolyl-3H-inden-5-ol | Drug Info | [48] | |||
26 | 2-(4-Hydroxy-phenyl)-4-methoxy-quinolin-6-ol | Drug Info | [54] | |||
27 | 2-(4-Hydroxy-phenyl)-4-vinyl-quinolin-6-ol | Drug Info | [54] | |||
28 | 2-(4-Hydroxy-phenyl)-7-isopropyl-benzooxazol-5-ol | Drug Info | [52] | |||
29 | 2-(4-Hydroxy-phenyl)-7-methoxy-benzofuran-5-ol | Drug Info | [55] | |||
30 | 2-(4-Hydroxy-phenyl)-7-methoxy-benzooxazol-5-ol | Drug Info | [52] | |||
31 | 2-(4-Hydroxy-phenyl)-7-methyl-benzofuran-5-ol | Drug Info | [55] | |||
32 | 2-(4-Hydroxy-phenyl)-7-phenyl-benzooxazol-5-ol | Drug Info | [52] | |||
33 | 2-(4-Hydroxy-phenyl)-7-propenyl-benzooxazol-5-ol | Drug Info | [52] | |||
34 | 2-(4-Hydroxy-phenyl)-7-propyl-benzooxazol-5-ol | Drug Info | [52] | |||
35 | 2-(4-Hydroxy-phenyl)-7-vinyl-benzooxazol-5-ol | Drug Info | [52] | |||
36 | 2-(4-Hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [52] | |||
37 | 2-(4-Hydroxy-phenyl)-benzooxazol-6-ol | Drug Info | [52] | |||
38 | 2-(4-Hydroxy-phenyl)-quinolin-6-ol | Drug Info | [54] | |||
39 | 2-(4-HYDROXY-PHENYL)BENZOFURAN-5-OL | Drug Info | [50], [52] | |||
40 | 2-(4-hydroxyphenyl)-1,2'-spirobi[1H-indene]-5-ol | Drug Info | [53] | |||
41 | 2-(5-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol | Drug Info | [52] | |||
42 | 2-(6-Hydroxy-naphthalen-1-yl)-benzooxazol-5-ol | Drug Info | [52] | |||
43 | 2-(6-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol | Drug Info | [52] | |||
44 | 2-(6-Hydroxy-naphthalen-2-yl)-benzooxazol-5-ol | Drug Info | [52] | |||
45 | 2-(6-Hydroxy-naphthalen-2-yl)-benzooxazol-6-ol | Drug Info | [52] | |||
46 | 2-Naphthalen-1-yl-benzooxazol-6-ol | Drug Info | [52] | |||
47 | 2-phenyl-1,2'-spirobi[1H-indene]-5'-ol | Drug Info | [53] | |||
48 | 3'-Methoxy-4'Hydroxyclomiphene | Drug Info | [56] | |||
49 | 3,4,6-Trihydroxy-2-(4-hydroxy-phenyl)-inden-1-one | Drug Info | [57] | |||
50 | 3,6-Dihydroxy-2-(4-hydroxy-phenyl)-inden-1-one | Drug Info | [57] | |||
51 | 3,8-dihydroxy-4-methyl-6H-benzo[c]chromen-6-one | Drug Info | [58] | |||
52 | 3,8-dihydroxy-7-methyl-6H-benzo[c]chromen-6-one | Drug Info | [58] | |||
53 | 3-(2-Hydroxy-phenyl)-benzo[d]isoxazol-6-ol | Drug Info | [52] | |||
54 | 3-(4-Hydroxy-phenyl)-4H-chromen-7-ol | Drug Info | [59] | |||
55 | 3-(4-Hydroxy-phenyl)-benzo[d]isoxazol-5-ol | Drug Info | [52] | |||
56 | 3-(4-Hydroxy-phenyl)-benzo[d]isoxazol-6-ol | Drug Info | [52] | |||
57 | 3-(5-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol | Drug Info | [52] | |||
58 | 3-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol | Drug Info | [52] | |||
59 | 3-chloro-4-(4-hydroxyphenyl)salicylaldoxime | Drug Info | [60] | |||
60 | 3-hydroxy-4,10-dimethyl-6H-benzo[c]chromen-6-one | Drug Info | [58] | |||
61 | 3-hydroxy-4,7-dimethyl-6H-benzo[c]chromen-6-one | Drug Info | [58] | |||
62 | 3-hydroxy-4-methyl-6H-benzo[c]chromen-6-one | Drug Info | [58] | |||
63 | 3-hydroxy-8,10-dimethyl-6H-benzo[c]chromen-6-one | Drug Info | [58] | |||
64 | 3-[1-ethyl-2-(3-hydroxyphenyl)butyl]phenol | Drug Info | [61] | |||
65 | 4',5,7-trihydroxy-6,8-dimethylisoflavone | Drug Info | [62] | |||
66 | 4,10-dimethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [58] | |||
67 | 4,6,10-trimethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [58] | |||
68 | 4,6,6,7-tetramethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [58] | |||
69 | 4,6,7,10-tetramethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [58] | |||
70 | 4,6,7-trimethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [58] | |||
71 | 4,7-dimethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [58] | |||
72 | 4-(2-phenyl-1H-benzo[d]imidazol-1-yl)phenol | Drug Info | [51] | |||
73 | 4-(2-phenyl-1H-indol-3-yl)phenol | Drug Info | [51] | |||
74 | 4-(3-(4-hydroxyphenyl)-1H-indol-2-yl)phenol | Drug Info | [51] | |||
75 | 4-(3-phenyl-1H-indol-2-yl)phenol | Drug Info | [51] | |||
76 | 4-(4-HYDROXYPHENYL)-1-NAPHTHALDEHYDE OXIME | Drug Info | [50] | |||
77 | 4-(5-Hydroxy-benzooxazol-2-yl)-benzene-1,3-diol | Drug Info | [52] | |||
78 | 4-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol | Drug Info | [52] | |||
79 | 4-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,3-diol | Drug Info | [52] | |||
80 | 4-Benzo[d]isoxazol-3-yl-benzene-1,3-diol | Drug Info | [52] | |||
81 | 4-Bromo-2-(4-hydroxy-phenyl)-quinolin-6-ol | Drug Info | [54] | |||
82 | 4-Chloro-2-(4-hydroxy-phenyl)-quinolin-6-ol | Drug Info | [54] | |||
83 | 4-Ethyl-2-(4-hydroxy-phenyl)-quinolin-6-ol | Drug Info | [54] | |||
84 | 4-Ethynyl-2-(4-hydroxy-phenyl)-quinolin-6-ol | Drug Info | [54] | |||
85 | 4-Naphthalen-2-yl-phenol | Drug Info | [49] | |||
86 | 4-[1,2-bis(4-hydroxyphenyl)but-1-enyl]phenol | Drug Info | [63] | |||
87 | 4-[1,2-bis(4-hydroxyphenyl)hex-1-enyl]phenol | Drug Info | [63] | |||
88 | 4-[1,2-bis(4-hydroxyphenyl)pent-1-enyl]phenol | Drug Info | [63] | |||
89 | 4-[1,2-bis(4-hydroxyphenyl)vinyl]phenol | Drug Info | [63] | |||
90 | 4-[2,2-bis(4-hydroxyphenyl)-1-methylvinyl]phenol | Drug Info | [63] | |||
91 | 5,7-dihydroxy-3-phenyl-3H-quinazolin-4-one | Drug Info | [64] | |||
92 | 5-Bromo-2-(4-hydroxy-phenyl)-quinolin-6-ol | Drug Info | [54] | |||
93 | 5-Chloro-2-(4-hydroxy-phenyl)-benzooxazol-6-ol | Drug Info | [52] | |||
94 | 5-Chloro-2-(4-hydroxy-phenyl)-quinolin-6-ol | Drug Info | [54] | |||
95 | 6-(2,5-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
96 | 6-(2,6-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
97 | 6-(2-Chloro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
98 | 6-(2-Fluoro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
99 | 6-(2-Hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
100 | 6-(3,5-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
101 | 6-(3-Chloro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
102 | 6-(3-Fluoro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
103 | 6-(3-Hydroxy-phenyl)-naphthalen-1-ol | Drug Info | [49] | |||
104 | 6-(3-Hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
105 | 6-(4-Hydroxy-2-methoxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
106 | 6-(4-Hydroxy-2-methyl-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
107 | 6-(4-Hydroxy-phenyl)-1-methoxy-naphthalen-2-ol | Drug Info | [49] | |||
108 | 6-(4-Hydroxy-phenyl)-1-methyl-naphthalen-2-ol | Drug Info | [49] | |||
109 | 6-(4-Hydroxy-phenyl)-1-nitro-naphthalen-2-ol | Drug Info | [49] | |||
110 | 6-(4-Hydroxy-phenyl)-1-phenyl-naphthalen-2-ol | Drug Info | [49] | |||
111 | 6-(4-Hydroxy-phenyl)-naphthalen-1-ol | Drug Info | [49] | |||
112 | 6-(4-Hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [54] | |||
113 | 6-Chloro-2-(4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [52] | |||
114 | 6-ethyl-4,7-dimethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [58] | |||
115 | 6-Phenyl-naphthalen-2-ol | Drug Info | [49] | |||
116 | 7-(3-Hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
117 | 7-(4-Hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
118 | 7-Allyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [52] | |||
119 | 7-Bromo-2-(4-hydroxy-phenyl)-benzofuran-5-ol | Drug Info | [55] | |||
120 | 7-Butyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [52] | |||
121 | 7-Chloro-2-(4-hydroxy-phenyl)-benzofuran-5-ol | Drug Info | [55] | |||
122 | 7-Ethyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [52] | |||
123 | 7-Ethynyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [52] | |||
124 | 7-hydroxy-1,2,9,9a-tetrahydrofluoren-3-one | Drug Info | [65] | |||
125 | 7-hydroxy-3-(4-hydroxyphenyl)-3H-quinazolin-4-one | Drug Info | [64] | |||
126 | 7-Phenyl-naphthalen-2-ol | Drug Info | [49] | |||
127 | 8-(2,2-dimethylpropyl)naringenin | Drug Info | [38] | |||
128 | 8-(2-methylpropyl)naringenin | Drug Info | [38] | |||
129 | 8-(3-methylbutyl)naringenin | Drug Info | [38] | |||
130 | 8-benzylnaringenin | Drug Info | [38] | |||
131 | 8-Chloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
132 | 8-Fluoro-6-(4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [49] | |||
133 | 8-methylnaringenin | Drug Info | [38] | |||
134 | 8-n-heptylnaringenin | Drug Info | [38] | |||
135 | 8-n-nonylnaringenin | Drug Info | [38] | |||
136 | 8-n-pentylnaringenin | Drug Info | [38] | |||
137 | 8-n-propylnaringenin | Drug Info | [38] | |||
138 | 8-n-undecylnaringenin | Drug Info | [38] | |||
139 | Acetate Ion | Drug Info | [66] | |||
140 | BROUSSONIN A | Drug Info | [68] | |||
141 | COUMESTROL | Drug Info | [59] | |||
142 | CP-394531 | Drug Info | [69] | |||
143 | CP-409069 | Drug Info | [69] | |||
144 | daidzein | Drug Info | [62] | |||
145 | DIHYDRORALOXIFENE | Drug Info | [71] | |||
146 | Doxorubicin-Formaldehyde Conjugate | Drug Info | [72] | |||
147 | EFFUSOL | Drug Info | [58] | |||
148 | Geldanamycin-estradiol hybrid | Drug Info | [74] | |||
149 | GNF-PF-3037 | Drug Info | [39] | |||
150 | MORIN | Drug Info | [39] | |||
151 | Nafoxidine | Drug Info | [76] | |||
152 | Para-Mercury-Benzenesulfonic Acid | Drug Info | [66] | |||
153 | SOPHORAFLAVANONE B | Drug Info | [38] | |||
154 | THIOGENISTEIN | Drug Info | [64] | |||
155 | TUPICHINOL C | Drug Info | [68] | |||
156 | WAY-169916 | Drug Info | [80] | |||
157 | ZK-164015 | Drug Info | [81] | |||
158 | [1,1':2',1'']Terphenyl-4'-carbaldehyde oxime | Drug Info | [82] | |||
Antagonist | [+] 7 Antagonist drugs | + | ||||
1 | Conjugated Estrogens | Drug Info | [1], [28] | |||
2 | MF-101 | Drug Info | [31] | |||
3 | EM-800 | Drug Info | [41] | |||
4 | HPTE | Drug Info | [75] | |||
5 | PHTPP | Drug Info | [77] | |||
6 | R,R-THC | Drug Info | [78] | |||
7 | Trans-hydroxytamoxifen | Drug Info | [79] | |||
Agonist | [+] 14 Agonist drugs | + | ||||
1 | Estrogen | Drug Info | [29] | |||
2 | AUS-131 | Drug Info | [33] | |||
3 | ERB-041 | Drug Info | [5], [34] | |||
4 | Erteberel | Drug Info | [35] | |||
5 | VG-101 | Drug Info | [36] | |||
6 | ERB-257 | Drug Info | [37] | |||
7 | ERB-196 | Drug Info | [43] | |||
8 | bisphenol A | Drug Info | [67] | |||
9 | diarylpropionitril | Drug Info | [70] | |||
10 | ERB-002 | Drug Info | [73] | |||
11 | GTx-878 | Drug Info | [73] | |||
12 | KB-9520 | Drug Info | [73] | |||
13 | NDC-1022 | Drug Info | [73] | |||
14 | WAY200070 | Drug Info | [52] | |||
Modulator | [+] 4 Modulator drugs | + | ||||
1 | Trilostane | Drug Info | [30] | |||
2 | Premarin/Pravachol | Drug Info | [9] | |||
3 | Genistein | Drug Info | [32] | |||
4 | GTx-822 | Drug Info | [73] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | Estrogen signaling pathway | |||||
2 | Prolactin signaling pathway | |||||
PID Pathway | [+] 3 PID Pathways | + | ||||
1 | Plasma membrane estrogen receptor signaling | |||||
2 | Validated nuclear estrogen receptor beta network | |||||
3 | Validated nuclear estrogen receptor alpha network | |||||
Reactome | [+] 1 Reactome Pathways | + | ||||
1 | Nuclear Receptor transcription pathway | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | SIDS Susceptibility Pathways | |||||
2 | Ovarian Infertility Genes | |||||
3 | Integrated Pancreatic Cancer Pathway | |||||
4 | Nuclear Receptors |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Differential biochemical and cellular actions of Premarin estrogens: distinct pharmacology of bazedoxifene-conjugated estrogens combination. Mol Endocrinol. 2009 Jan;23(1):74-85. | |||||
REF 2 | Clinical pipeline report, company report or official report of Lilly. | |||||
REF 3 | ClinicalTrials.gov (NCT00190697) A Study of LY353381 (Arzoxifene) for Patients Who Benefitted From This Drug in Other Oncology Trials and Wished to Continue Treatment. U.S. National Institutes of Health. | |||||
REF 4 | ClinicalTrials.gov (NCT01613170) Premarin Versus Toviaz for Treatment of Overactive Bladder. U.S. National Institutes of Health. | |||||
REF 5 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6850). | |||||
REF 7 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 018719. | |||||
REF 8 | ClinicalTrials.gov (NCT00906308) A Study of MF101 in Postmenopausal Women. U.S. National Institutes of Health. | |||||
REF 9 | Lovastatin and beyond: the history of the HMG-CoA reductase inhibitors. Nat Rev Drug Discov. 2003 Jul;2(7):517-26. | |||||
REF 10 | ClinicalTrials.gov (NCT00355953) Vascular and Skeletal Protective Effects of Genistein in Postmenopausal Women. U.S. National Institutes of Health. | |||||
REF 11 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030256) | |||||
REF 12 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6700). | |||||
REF 13 | ClinicalTrials.gov (NCT00318500) Study Evaluating the Safety and Efficacy of ERB-041 on Reduction of Symptoms Associated With Endometriosis in Reproductive-Aged Women. U.S. National Institutes of Health. | |||||
REF 14 | ClinicalTrials.gov (NCT01874756) The Efficacy and Safety of a Selective Estrogen Receptor Beta Agonist (LY500307) for Negative Symptoms and Cognitive Impairment Associated With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 15 | ClinicalTrials.gov (NCT00453089) VG101 Phase I/II to Treat Vulvar and Vaginal Atrophy in Post-Menopausal Women. U.S. National Institutes of Health. | |||||
REF 16 | ClinicalTrials.gov (NCT00722202) Study Evaluating the Safety and Pharmacokinetics (PK) of Ascending Single IV Doses of ERB-257 in Healthy Japanese Males. U.S. National Institutes of Health. | |||||
REF 17 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2338). | |||||
REF 18 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2823). | |||||
REF 19 | Carcinogenicity and metabolic activation of hexestrol. Chem Biol Interact. 1985 Oct;55(1-2):157-76. | |||||
REF 20 | Comparison of the ligand binding specificity and transcript tissue distribution of estrogen receptors alpha and beta. Endocrinology. 1997 Mar;138(3):863-70. | |||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009862) | |||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011640) | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021229) | |||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015080) | |||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000792) | |||||
REF 26 | Pharmacological characterization of a novel oestrogen antagonist, ZK 119010, in rats and mice. J Endocrinol. 1991 Sep;130(3):409-14. | |||||
REF 27 | Benzothiophene selective estrogen receptor modulators with modulated oxidative activity and receptor affinity. J Med Chem. 2007 May 31;50(11):2682-92. | |||||
REF 28 | Knockouts model the 100 best-selling drugs--will they model the next 100 Nat Rev Drug Discov. 2003 Jan;2(1):38-51. | |||||
REF 29 | Estrogen inhibits the vascular injury response in estrogen receptor beta-deficient female mice. Proc Natl Acad Sci U S A. 1999 Dec 21;96(26):15133-6. | |||||
REF 30 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 31 | MF101, a selective estrogen receptor beta modulator for the treatment of menopausal hot flushes: a phase II clinical trial. Menopause. 2009 May-Jun;16(3):458-65. | |||||
REF 32 | Company report (Axcentua) | |||||
REF 33 | S-equol, a potent ligand for estrogen receptor beta, is the exclusive enantiomeric form of the soy isoflavone metabolite produced by human intestinal bacterial flora. Am J Clin Nutr. 2005 May;81(5):1072-9. | |||||
REF 34 | Erb-041, an estrogen receptor-beta agonist, inhibits skin photocarcinogenesis in SKH-1 hairless mice by downregulating the WNT signaling pathway. Cancer Prev Res (Phila). 2014 Feb;7(2):186-98. | |||||
REF 35 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031986) | |||||
REF 36 | Update on alternative therapies for vulvovaginal atrophy. Patient Prefer Adherence. 2011; 5: 533-536. | |||||
REF 37 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030075) | |||||
REF 38 | Subtle side-chain modifications of the hop phytoestrogen 8-prenylnaringenin result in distinct agonist/antagonist activity profiles for estrogen re... J Med Chem. 2006 Dec 14;49(25):7357-65. | |||||
REF 39 | In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. | |||||
REF 40 | Bone targeted drugs 2. synthesis of estrogens with hydroxyapatite affinity, Bioorg. Med. Chem. Lett. 6(9):1047-1050 (1996). | |||||
REF 41 | EM-800, a novel antiestrogen, acts as a pure antagonist of the transcriptional functions of estrogen receptors alpha and beta. Endocrinology. 1998 Jan;139(1):111-8. | |||||
REF 42 | Design, synthesis, and preclinical characterization of novel, highly selective indole estrogens. J Med Chem. 2001 May 24;44(11):1654-7. | |||||
REF 43 | WAY-202196, a selective estrogen receptor-beta agonist, protects against death in experimental septic shock. Crit Care Med. 2006 Aug;34(8):2188-93. | |||||
REF 44 | Androstene-3,5-dienes as ER-beta selective SERMs. Bioorg Med Chem Lett. 2007 Nov 15;17(22):6295-8. | |||||
REF 45 | Synthesis and biological activity of new halo-steroidal antiestrogens. J Med Chem. 1991 May;34(5):1624-30. | |||||
REF 46 | Structure-activity relationship of antiestrogens. Phenolic analogues of 2,3-diaryl-2H-1-benzopyrans. J Med Chem. 1990 Dec;33(12):3222-9. | |||||
REF 47 | 2-Phenylindole-linked [2-(aminoalkyl)pyridine]dichloroplatinum(II): complexes with a selective action on estrogen receptor positive mammary tumors. J Med Chem. 1991 Jul;34(7):2145-52. | |||||
REF 48 | Differential response of estrogen receptor subtypes to 1,3-diarylindene and 2,3-diarylindene ligands. J Med Chem. 2005 Sep 22;48(19):5989-6003. | |||||
REF 49 | ERbeta ligands. 3. Exploiting two binding orientations of the 2-phenylnaphthalene scaffold to achieve ERbeta selectivity. J Med Chem. 2005 Jun 16;48(12):3953-79. | |||||
REF 50 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
REF 51 | Estrogen receptor beta selective ligands: discovery and SAR of novel heterocyclic ligands. Bioorg Med Chem Lett. 2005 Dec 15;15(24):5562-6. | |||||
REF 52 | Design and synthesis of aryl diphenolic azoles as potent and selective estrogen receptor-beta ligands. J Med Chem. 2004 Oct 7;47(21):5021-40. | |||||
REF 53 | 2-Phenylspiroindenes: a novel class of selective estrogen receptor modulators (SERMs). Bioorg Med Chem Lett. 2003 Feb 10;13(3):479-83. | |||||
REF 54 | ERbeta ligands. Part 4: Synthesis and structure-activity relationships of a series of 2-phenylquinoline derivatives. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4520-5. | |||||
REF 55 | 7-Substituted 2-phenyl-benzofurans as ER beta selective ligands. Bioorg Med Chem Lett. 2004 Oct 4;14(19):4925-9. | |||||
REF 56 | Phenolic metabolites of clomiphene: [(E,Z)-2-[4-(1,2-diphenyl-2-chlorovinyl)phenoxy]ethyl]diethylamine. Preparation, electrophilicity, and effects ... J Med Chem. 1989 Jan;32(1):192-7. | |||||
REF 57 | Estrogen receptor ligands: design and synthesis of new 2-arylindene-1-ones. Bioorg Med Chem Lett. 2005 Jun 15;15(12):3137-42. | |||||
REF 58 | 6H-Benzo[c]chromen-6-one derivatives as selective ERbeta agonists. Bioorg Med Chem Lett. 2006 Mar 15;16(6):1468-72. | |||||
REF 59 | Structure-based virtual screening for plant-based ERbeta-selective ligands as potential preventative therapy against age-related neurodegenerative ... J Med Chem. 2005 May 19;48(10):3463-6. | |||||
REF 60 | Monoaryl-substituted salicylaldoximes as ligands for estrogen receptor beta. J Med Chem. 2008 Mar 13;51(5):1344-51. | |||||
REF 61 | Influence of alkyl chain ramification on estradiol receptor binding affinity and intrinsic activity of 1,2-dialkylated 1,2-bis(4- or 3-hydroxypheny... J Med Chem. 1986 Sep;29(9):1668-74. | |||||
REF 62 | Isolation and structure elucidation of an isoflavone and a sesterterpenoic acid from Henriettella fascicularis. J Nat Prod. 2002 Dec;65(12):1749-53. | |||||
REF 63 | Antiestrogenically active 1,1,2-tris(4-hydroxyphenyl)alkenes without basic side chain: synthesis and biological activity. J Med Chem. 2003 Apr 10;46(8):1484-91. | |||||
REF 64 | Synthesis and characterization of 3-arylquinazolinone and 3-arylquinazolinethione derivatives as selective estrogen receptor beta modulators. J Med Chem. 2006 Apr 20;49(8):2440-55. | |||||
REF 65 | The discovery of tetrahydrofluorenones as a new class of estrogen receptor beta-subtype selective ligands. Bioorg Med Chem Lett. 2006 Jul 1;16(13):3489-94. | |||||
REF 66 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
REF 67 | Structure-activity relationships of bisphenol A analogs at estrogen receptors (ERs): discovery of an ERalpha-selective antagonist. Bioorg Med Chem Lett. 2013 Jul 15;23(14):4031-6. | |||||
REF 68 | New estrogenic compounds isolated from Broussonetia kazinoki. Bioorg Med Chem Lett. 2010 Jun 15;20(12):3764-7. | |||||
REF 69 | Discovery of potent, nonsteroidal, and highly selective glucocorticoid receptor antagonists. J Med Chem. 2002 Jun 6;45(12):2417-24. | |||||
REF 70 | Estrogen receptor-beta potency-selective ligands: structure-activity relationship studies of diarylpropionitriles and their acetylene and polar analogues. J Med Chem. 2001 Nov 22;44(24):4230-51. | |||||
REF 71 | Synthesis and biological activity of trans-2,3-dihydroraloxifene. Bioorg Med Chem Lett. 1999 Apr 19;9(8):1137-40. | |||||
REF 72 | Design, synthesis, and biological evaluation of doxorubicin-formaldehyde conjugates targeted to breast cancer cells. J Med Chem. 2004 Feb 26;47(5):1193-206. | |||||
REF 73 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 621). | |||||
REF 74 | Synthesis and evaluation of geldanamycin-estradiol hybrids. Bioorg Med Chem Lett. 1999 May 3;9(9):1233-8. | |||||
REF 75 | Signalling by CXC-chemokine receptors 1 and 2 expressed in CHO cells: a comparison of calcium mobilization, inhibition of adenylyl cyclase and stimulation of GTPgammaS binding induced by IL-8 and GROalpha. Br J Pharmacol. 1999 Feb;126(3):810-8. | |||||
REF 76 | Discovery and preclinical pharmacology of a novel, potent, nonsteroidal estrogen receptor agonist/antagonist, CP-336156, a diaryltetrahydronaphthal... J Med Chem. 1998 Jul 30;41(16):2928-31. | |||||
REF 77 | Structure-guided optimization of estrogen receptor binding affinity and antagonist potency of pyrazolopyrimidines with basic side chains. J Med Chem. 2007 Jan 25;50(2):399-403. | |||||
REF 78 | Estrogen receptor subtype-selective ligands: asymmetric synthesis and biological evaluation of cis- and trans-5,11-dialkyl- 5,6,11, 12-tetrahydrochrysenes. J Med Chem. 1999 Jul 1;42(13):2456-68. | |||||
REF 79 | Antagonists selective for estrogen receptor alpha. Endocrinology. 2002 Mar;143(3):941-7. | |||||
REF 80 | Synthesis and activity of substituted 4-(indazol-3-yl)phenols as pathway-selective estrogen receptor ligands useful in the treatment of rheumatoid ... J Med Chem. 2004 Dec 16;47(26):6435-8. | |||||
REF 81 | Synthesis and biological evaluation of stilbene-based pure estrogen antagonists. Bioorg Med Chem Lett. 2004 Sep 20;14(18):4659-63. | |||||
REF 82 | Novel estrogen receptor ligands based on an anthranylaldoxime structure: role of the phenol-type pseudocycle in the binding process. J Med Chem. 2003 Sep 11;46(19):4032-42. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.