Target Information

Target General Infomation
Target ID
T77365
Former ID
TTDS00187
Target Name
Adenosine A2a receptor
Gene Name
ADORA2A
Synonyms
A(2A) adenosine receptor; A2a Adenosine receptor; Adenosine receptor A2a; ADORA2A
Target Type
Successful
Disease Arteriosclerosis [ICD9: 440; ICD10: I70]
Asthma; Chronic obstructive pulmonary disease [ICD9: 490-492, 493, 494-496; ICD10: J40-J44, J47, J45]
Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4]
Coronary disorder diagnosis [ICD9: 410-414, 429.2; ICD10: I20-I25]
Diabetic foot ulcer [ICD9: 707; ICD10: L88-L89]
Fatigue; Orthostatic hypotension [ICD9: 458.0, 780.7; ICD10: I95.1, R53]
Glaucoma [ICD9: 365; ICD10: H40-H42]
Hypertension [ICD9: 401; ICD10: I10-I16]
Hyperlipidaemia [ICD9: 272.0-272.4; ICD10: E78]
Multiple scierosis [ICD9: 340; ICD10: G35]
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0]
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89]
Parkinson's disease [ICD9: 332; ICD10: G20]
Radionuclide imaging [ICD10: W88]
Schizophrenia [ICD9: 295; ICD10: F20]
Function
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
BioChemical Class
GPCR rhodopsin
Target Validation
T77365
UniProt ID
P29274
Sequence
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Drugs and Mode of Action
Drug(s) Caffeine Drug Info Approved Fatigue; Orthostatic hypotension [536949], [540664]
Regadenoson Drug Info Approved Radionuclide imaging [529941], [540964]
Apadenoson Drug Info Phase 3 Coronary disorder diagnosis [522811], [540254]
Binodenoson Drug Info Phase 3 Hypertension [522738], [540963]
KW-6002 Drug Info Phase 3 Parkinson's disease [551079]
Tozadenant Drug Info Phase 3 Parkinson's disease [525212], [540980]
Tonapofylline Drug Info Phase 2/3 Discovery agent [522369], [540973]
AMP-579 Drug Info Phase 2 Hyperlipidaemia [544253]
BIIB014 Drug Info Phase 2 Parkinson's disease [536285], [540981]
Dexefaroxan Drug Info Phase 2 Parkinson's disease [526560]
MRE-0094 Drug Info Phase 2 Diabetic foot ulcer [536297]
SCH 420814 Drug Info Phase 2 Parkinson's disease [536285], [540983]
UK-432097 Drug Info Phase 2 Asthma; Chronic obstructive pulmonary disease [521962], [543123]
ATL-313 Drug Info Phase 1/2 Arteriosclerosis [523322], [540962]
OPA-6566 Drug Info Phase 1/2 Glaucoma [523581]
V81444 Drug Info Phase 1/2 Parkinson's disease [524937]
GW-328267 Drug Info Phase 1 Allergic rhinitis [523974]
KF-17837 Drug Info Phase 1 Parkinson's disease [546031]
SCH-442416 Drug Info Phase 1 Discovery agent [522117], [540246]
BVT-115959 Drug Info Discontinued in Phase 2 Pain [548203]
Dexefaroxan Drug Info Discontinued in Phase 2 Schizophrenia [536463]
Lu-AA47070 Drug Info Discontinued in Phase 1 Parkinson's disease [548653]
T-62 Drug Info Discontinued in Phase 1 Neuropathic pain [536374]
ARISTEROMYCIN Drug Info Terminated Discovery agent [546315]
CGS 21680 Drug Info Terminated Discovery agent [540510], [544564]
METHYLTHIOADENOSINE Drug Info Terminated Multiple scierosis [544778]
METRIFUDIL Drug Info Terminated Discovery agent [467595], [546171]
ZM-241385 Drug Info Terminated Discovery agent [540649], [546100]
Inhibitor (1H-Imidazo[4,5-c]quinolin-4-yl)-phenyl-amine HCl Drug Info [530590]
(2R,3S)-3-(6-Amino-purin-9-yl)-nonan-2-ol Drug Info [533722]
(3-amino-5-bromobenzofuran-2-yl)(phenyl)methanone Drug Info [530650]
(E,E)-8-(4-Phenylbutadien-1-yl)caffeine Drug Info [529653]
(E,E)-8-[4-(3-Bromophenyl)butadien-1-yl]caffeine Drug Info [529653]
(E,E)-8-[4-(3-Chlorophenyl)butadien-1-yl]caffeine Drug Info [529653]
(E,E)-8-[4-(3-Fluorophenyl)butadien-1-yl]caffeine Drug Info [529653]
(S)-DHPA Drug Info [530014]
(Z)-8-(3-chlorostyryl)caffeine Drug Info [529653]
1,3,7-Tripropyl-3,7-dihydro-purine-2,6-dione Drug Info [533486]
1,3,8-Trimethyl-3,7-dihydro-purine-2,6-dione Drug Info [533394]
1,3-Diallyl-3,7-dihydro-purine-2,6-dione Drug Info [533429]
1,3-Diallyl-7-methyl-3,7-dihydro-purine-2,6-dione Drug Info [533486]
1,3-Dibenzyl-3,7-dihydro-purine-2,6-dione Drug Info [533486]
1,3-Diethyl-3,7-dihydro-purine-2,6-dione Drug Info [533429]
1,3-Diisobutyl-3,7-dihydro-purine-2,6-dione Drug Info [533486]
1,3-Dipropyl-3,7-dihydro-purine-2,6-dione Drug Info [533429]
1,4-diaminoanthracene-9,10-dione Drug Info [530650]
1-Allyl-3,7-dimethyl-3,7-dihydro-purine-2,6-dione Drug Info [533486]
1-amino-2,4-bis(phenylthio)anthracene-9,10-dione Drug Info [530650]
1-amino-2-phenoxyanthracene-9,10-dione Drug Info [530650]
1-amino-4-chloroanthracene-9,10-dione Drug Info [530650]
1-amino-4-methoxyanthracene-9,10-dione Drug Info [530650]
1-aminoanthracene-9,10-dione Drug Info [530650]
1-Butyl-8-phenyl-3,7-dihydro-purine-2,6-dione Drug Info [526958]
1-Ethyl-3-methyl-3,7-dihydro-purine-2,6-dione Drug Info [533486]
1-Methyl-8-phenyl-3,7-dihydro-purine-2,6-dione Drug Info [526958]
1-METHYLXANTHINE Drug Info [533429]
1-Phenyl-3-(4-pyridin-2-yl-thiazol-2-yl)-urea Drug Info [526011]
1H-Imidazo[4,5-c]quinolin-4-ylamine HCl Drug Info [530590]
2,5'-dichloro-5'-deoxy-N6-cyclopentyladenosine Drug Info [530035]
2,6,8-triphenyl-9H-purine Drug Info [528192]
2,6-diphenyl-1-deazapurine Drug Info [528673]
2,6-diphenyl-8-(1-ethylpropyl)-1-deazapurine Drug Info [528673]
2,6-diphenyl-8-ethyl-1-deazapurine Drug Info [528673]
2,6-diphenyl-8-methyl-1-deazapurine Drug Info [528673]
2,6-diphenyl-8-tButyl-1-deazapurine Drug Info [528673]
2,6-diphenyl-9H-purine Drug Info [528192]
2,6-Diphenyl-pyrimidin-4-ylamine Drug Info [529299]
2,6-dphenyl-8-propyl-1-deazapurine Drug Info [528673]
2-(1H-benzo[d]imidazol-2-yl)quinoxaline Drug Info [529313]
2-(2''-indolylethyloxy)adenosine Drug Info [528748]
2-(2-furyl)-6-(1H-pyrazol-1-yl)pyrimidin-4-amine Drug Info [529255]
2-(3''(5''-chloro-indolyl)ethyloxy)adenosine Drug Info [528748]
2-(3''(7''-bromo-indolyl)ethyloxy)adenosine Drug Info [528748]
2-(3''-(4''-bromo-indolyl)ethyloxy)adenosine Drug Info [528748]
2-(3''-(5''-bromo-indolyl)ethyloxy)adenosine Drug Info [528748]
2-(3''-(5''-fluoro-indolyl)ethyloxy)adenosine Drug Info [528748]
2-(3''-(5''-hydroxyindolyl)ethyloxy)adenosine Drug Info [528748]
2-(3''-(5''-iodo-indolyl)ethyloxy)adenosine Drug Info [528748]
2-(3''-(5''-methoxy-indolyl)ethyloxy)adenosine Drug Info [528748]
2-(3''-(6''-bromo-indolyl)ethyloxy)adenosine Drug Info [528748]
2-(3''-(6''-chloro-indolyl)ethyloxy)adenosine Drug Info [528748]
2-(3''-(benzoimidazole-1''-yl)ethyloxy)adenosine Drug Info [528748]
2-(3''-indolylethyloxy)adenosine Drug Info [528748]
2-(3''-pyrrolylethyloxy)adenosine Drug Info [528748]
2-(4-chlorophenyl)-6-phenyl-9H-purine Drug Info [528192]
2-(4-ethylthiobenzimidazol-2-yl)quinoxaline Drug Info [527933]
2-(4-hydroxypent-1-yl)-N6-methoxyadenosine Drug Info [528684]
2-(4-methyl-1H-benzo[d]imidazol-2-yl)quinoxaline Drug Info [529313]
2-(5-cyano-1-pent-1-ynyl)-N6-methoxyadenosine Drug Info [528684]
2-(6-amino-8-bromo-9H-purin-9-yl)ethanol Drug Info [530966]
2-(hex-1-ynyl)-N6-methoxyadenosine Drug Info [528684]
2-amino-3-(m-tolylamino)naphthalene-1,4-dione Drug Info [530650]
2-Amino-4,6-di-furan-2-yl-nicotinonitrile Drug Info [529602]
2-Amino-4,6-di-thiophen-2-yl-nicotinonitrile Drug Info [529602]
2-Amino-4,6-diphenyl-nicotinonitrile Drug Info [529602]
2-Amino-4,6-diphenyl-pyrimidin-5-carbonitrile Drug Info [529299]
2-Amino-4,6-diphenyl-pyrimidine Drug Info [529299]
2-Amino-4-furan-2-yl-6-phenyl-nicotinonitrile Drug Info [529602]
2-Amino-4-phenyl-6-thiophen-2-yl-nicotinonitrile Drug Info [529602]
2-Amino-6-furan-2-yl-4-phenyl-nicotinonitrile Drug Info [529602]
2-amino-6-phenyl-4-p-tolylnicotinonitrile Drug Info [528434]
2-Amino-6-phenyl-4-thiophen-2-yl-nicotinonitrile Drug Info [529602]
2-amino-N-benzyl-6-phenyl-9H-purine-9-carboxamide Drug Info [529421]
2-chloro-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine Drug Info [529419]
2-chloro-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine Drug Info [529419]
2-chloro-N6-cyclopentyladenosine Drug Info [529098]
2-Cyclopentyl-1H-imidazo[4,5-c]quinolin-4-ylamine Drug Info [530590]
2-ethyl-4-(furan-2-yl)thieno[3,2-d]pyrimidine Drug Info [529419]
2-ethyl-4-(furan-3-yl)thieno[3,2-d]pyrimidine Drug Info [529419]
2-ethyl-4-(pyridin-2-yl)thieno[3,2-d]pyrimidine Drug Info [529419]
2-ethyl-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine Drug Info [529419]
2-ethyl-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine Drug Info [529419]
2-ethynyl-N6-methoxyadenosine Drug Info [528684]
2-m-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine Drug Info [528969]
2-p-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine Drug Info [528969]
2-Phenyl-1H-imidazo[4,5-c]quinolin-4-ylamine Drug Info [530590]
2-phenyl-2H-pyrazolo[3,4-c]quinolin-4-amine Drug Info [528969]
2-phenylpropoxyadenosine Drug Info [528748]
2-tolyl-6-phenyl-9H-purine Drug Info [528192]
2-[(4-acetylphenyl)ethynyl]-N6-methoxyadenosine Drug Info [528684]
2-[(4-fluorophenyl)ethynyl]-N6-methoxyadenosine Drug Info [528684]
3-Benzyl-7-methyl-[1,8]naphthyridin-4-ol Drug Info [527683]
3-Benzyl-7-methyl-[1,8]naphthyridine-4-thiol Drug Info [527683]
3-Isobutyl-1-methyl-3,9-dihydro-purine-2,6-dione Drug Info [533486]
3-Isopropyl-1-methyl-3,7-dihydro-purine-2,6-dione Drug Info [533486]
3-noradamantyl-1,3-dipropylxanthine Drug Info [528544]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one Drug Info [531079]
4-(ethylthio)-6-phenyl-1,3,5-triazin-2-amine Drug Info [528434]
4-(furan-2-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine Drug Info [529858]
4-(furan-2-yl)thieno[3,2-d]pyrimidin-2-amine Drug Info [529421]
4-(thiazol-2-yl)thieno[3,2-d]pyrimidin-2-amine Drug Info [529419]
4-Amino-2,6-diphenyl-pyrimidine-5-carbonitrile Drug Info [529299]
4-amino-2-p-tolylisoindoline-1,3-dione Drug Info [530650]
5,7-dibromo-9H-pyrido[3,4-b]indol-6-ol Drug Info [529305]
5,7-diphenyl-3H-imidazo[4,5-b]pyridin-2-ol Drug Info [528673]
5-Azido-6-benzyl-2-methyl-[1,8]naphthyridine Drug Info [527683]
5-Butyl-8-phenyl-3H-[1,2,4]triazolo[5,1-i]purine Drug Info [527055]
6-(furan-2-yl)-9H-purin-2-amine Drug Info [529858]
6-Furan-2-yl-9-phenethyl-9H-purin-2-ylamine Drug Info [527503]
6-Furan-2-yl-9-phenyl-9H-purin-2-ylamine Drug Info [527503]
6-guanidino-2-(3''-indolylethyloxy)adenosine Drug Info [528748]
7-Allyl-1,3-dimethyl-3,7-dihydro-purine-2,6-dione Drug Info [533486]
7-Allyl-1,3-dipropyl-3,7-dihydro-purine-2,6-dione Drug Info [533486]
7-Isopropyl-7H-adenine Drug Info [530014]
7-Propyl-7H-adenine Drug Info [530014]
8-Br-adenine Drug Info [530014]
8-Bromo-9-(2,3-dihydroxypropyl)-9H-adenine Drug Info [530014]
8-Bromo-9-(2-butyl)-9H-adenine Drug Info [530014]
8-Bromo-9-(2-hydroxypropyl)-9H-adenine Drug Info [530014]
8-Bromo-9-(3-hydroxypropyl)-9H-adenine Drug Info [530014]
8-Bromo-9-(but-3-enyl)-9H-adenine Drug Info [530014]
8-Bromo-9-(sec-butyl)-9H-adenine Drug Info [530014]
8-Bromo-9-cyclobutyl-9H-adenine Drug Info [530014]
8-Bromo-9-cyclohexyl-9H-adenine Drug Info [530014]
8-Bromo-9-cyclopentyl-9H-adenine Drug Info [530014]
8-Bromo-9-ethyl-9H-adenine Drug Info [530014]
8-bromo-9-isobutyl-9H-purin-6-amine Drug Info [530966]
8-Bromo-9-isopropyl-9H-adenine Drug Info [530014]
8-Bromo-9-methyl-9H-adenine Drug Info [530014]
8-Bromo-9-phenylethyl-9H-adenine Drug Info [530014]
8-Bromo-9-propyl-9H-adenine Drug Info [530014]
8-PHENYL THEOPHYLLINE Drug Info [530590]
8-Phenyl-1-propyl-3,7-dihydro-purine-2,6-dione Drug Info [526958]
8-propyl-2,6-diphenyl-9H-purine Drug Info [528192]
9-(2-Hydroxyethyl)-9H-adenine Drug Info [530014]
9-(2-Hydroxypropyl)-9H-adenine Drug Info [530014]
9-(3-aminobenzyl)-6-(furan-2-yl)-9H-purin-2-amine Drug Info [529421]
9-(3-Hydroxypropyl)-9H-adenine Drug Info [530014]
9-(3-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine Drug Info [529421]
9-(4-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine Drug Info [529421]
9-(sec-Butyl)-9H-adenine Drug Info [530014]
9-Allyl-8-bromo-9H-adenine Drug Info [530014]
9-benzyl-6-(furan-2-yl)-9H-purin-2-amine Drug Info [529421]
9-Benzyl-8-bromo-9H-adenine Drug Info [530014]
9-BENZYL-9H-ADENINE Drug Info [530014]
9-But-3-enyl-9H-adenine Drug Info [530014]
9-Butyl-9H-adenine Drug Info [530014]
9-Cyclobutyl-9H-adenine Drug Info [530014]
9-Cycloheptyl-9H-adenine Drug Info [530014]
9-Cyclopentyl-9H-adenine Drug Info [530014]
9-Cyclopropyl-9H-adenine Drug Info [530014]
9-Ethyl-8-phenylethynyl-9H-purin-6-ylamine Drug Info [526104]
9-Ethyl-9H-adenine Drug Info [530014]
9-Isopropyl-9H-adenine Drug Info [530014]
9-Methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine Drug Info [527823]
9-Methyl-9H-adenine Drug Info [530014]
9-Phenylethyl-9H-adenine Drug Info [530014]
9-Propyl-9H-adenine Drug Info [530014]
ALLOXAZINE Drug Info [527823]
ARISTEROMYCIN Drug Info [525783]
Cyclohexyl-(2-phenoxy-9H-purin-6-yl)-amine Drug Info [527647]
Cyclohexyl-(2-phenylsulfanyl-9H-purin-6-yl)-amine Drug Info [527647]
Ethyl 5-benzoyl-4-phenylthiazol-2-ylcarbamate Drug Info [530752]
FR-166124 Drug Info [525562]
GALANGIN Drug Info [534439]
GNF-PF-2224 Drug Info [530672]
GNF-PF-2700 Drug Info [530966]
ISOGUANOSINE Drug Info [551229]
KF-17837 Drug Info [533955]
Kuanoniamine D Drug Info [534583]
LUF-5417 Drug Info [530752]
LUF-5433 Drug Info [530752]
LUF-5437 Drug Info [526011]
LUF-5767 Drug Info [527331]
LUF-5956 Drug Info [528192]
LUF-5957 Drug Info [528192]
LUF-5962 Drug Info [528192]
LUF-5978 Drug Info [528673]
LUF-5980 Drug Info [528673]
LUF-5981 Drug Info [528673]
Methyl 7-methoxy-4-phenylbenzofuran-2-ylcarbamate Drug Info [530599]
METHYLTHIOADENOSINE Drug Info [527040]
METRIFUDIL Drug Info [525578]
N*6*-Cyclohexyl-N*2*-phenyl-9H-purine-2,6-diamine Drug Info [527647]
N-(2,6-diphenylpyrimidin-4-yl)-2-ethylbutyramide Drug Info [527331]
N-(2,6-diphenylpyrimidin-4-yl)-3-methylbutyramide Drug Info [527331]
N-(2,6-diphenylpyrimidin-4-yl)acetamide Drug Info [527331]
N-(2,6-diphenylpyrimidin-4-yl)butyramide Drug Info [527331]
N-(2,6-diphenylpyrimidin-4-yl)isobutyramide Drug Info [527331]
N-(2,6-diphenylpyrimidin-4-yl)propionamide Drug Info [527331]
N-(2-(furan-2-yl)-3,4'-bipyridin-6-yl)acetamide Drug Info [530694]
N-(3-Phenyl-[1,2,4]thiadiazol-5-yl)-benzamide Drug Info [526011]
N-(4,6-diphenylpyrimidin-2-yl)propionamide Drug Info [527331]
N-(4-Pyridin-2-yl-thiazol-2-yl)-benzamide Drug Info [526011]
N-(5-Benzoyl-4-phenylthiazol-2-yl)benzamide Drug Info [530752]
N-(7-methoxy-4-phenylbenzofuran-2-yl)acetamide Drug Info [530599]
N6-((+/-)-endo-norborn-2-yl)adenosine Drug Info [530035]
N6-(4-hydroxybenzyl)adenine riboside Drug Info [528752]
N6-CYCLOPENTYLADENOSINE Drug Info [530752]
N6-methoxy-2-phenylethynyladenosine Drug Info [528684]
N6-methoxy-2-[(2-pyridinyl)ethynyl]adenosine Drug Info [528684]
N6-methoxy-2-[(3-pyridinyl)ethynyl]-adenosine Drug Info [528684]
N6-methoxy-2-[(4-methoxyphenyl)ethynyl]adenosine Drug Info [528684]
N6-methoxy-2-[(4-pentylphenyl)ethynyl]adenosine Drug Info [528684]
N6-methoxy-2-[(4-pyridinyl)ethynyl]adenosine Drug Info [528684]
N6-methoxy-2-[2-(trimethylsilyl)ethynyl]adenosine Drug Info [528684]
N6-[(4-Amino)-phenyl]-9-benzyl-2-phenyladenine Drug Info [529183]
N6-[(4-Nitro)-phenyl]-9-benzyl-2-phenyladenine Drug Info [529183]
NECA Drug Info [533449]
OSIP-339391 Drug Info [530966]
PD-115199 Drug Info [527717]
Phenyl 7-methoxy-4-phenylbenzofuran-2-ylcarbamate Drug Info [530599]
Phenyl(2-(trifluoromethyl)quinolin-4-yl)methanol Drug Info [529418]
PSB-0788 Drug Info [530243]
PSB-09120 Drug Info [530243]
PSB-601 Drug Info [530243]
R-N6-(phenylisopropyl)adenosine Drug Info [528748]
SB-298 Drug Info [530243]
SCH-442416 Drug Info [525917]
SCH-63390 Drug Info [534646]
ST-1535 Drug Info [529602]
Tonapofylline Drug Info [530752]
ZM-241385 Drug Info [530372]
Modulator AMP-579 Drug Info [527148]
GW-328267 Drug Info
KW-6002 Drug Info
MSX-3 Drug Info [540978]
Regadenoson Drug Info [551871]
Agonist Apadenoson Drug Info [540254]
ATL-313 Drug Info [528143]
Binodenoson Drug Info [528865]
BVT-115959 Drug Info [531316]
CGS 21680 Drug Info [535415]
Dexefaroxan Drug Info [536463]
MRE-0094 Drug Info [536297]
OPA-6566 Drug Info [550203]
UK-432097 Drug Info [531387]
Antagonist BIIB014 Drug Info [536285]
Caffeine Drug Info [535951], [536302]
Lu-AA47070 Drug Info [531680]
SCH 420814 Drug Info [536285]
SCH58261 Drug Info [535245], [535757]
T-62 Drug Info [536374]
Tozadenant Drug Info [532878]
V81444 Drug Info [532726]
Pathways
KEGG Pathway Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Vascular smooth muscle contraction
Parkinson&#039
s disease
Alcoholism
Pathway Interaction Database HIF-2-alpha transcription factor network
PathWhiz Pathway Intracellular Signalling Through Adenosine Receptor A2a and Adenosine
Reactome NGF-independant TRKA activation
Adenosine P1 receptors
G alpha (s) signalling events
Surfactant metabolism
WikiPathways Nucleotide GPCRs
Monoamine Transport
GPCRs, Class A Rhodopsin-like
NGF signalling via TRKA from the plasma membrane
GPCR ligand binding
GPCR downstream signaling
GPCRs, Other
References
Ref 467595(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 426).
Ref 521962ClinicalTrials.gov (NCT00430300) Safety And Efficacy Of UK-432,097 In Chronic Obstructive Pulmonary Disease.. U.S. National Institutes of Health.
Ref 522117ClinicalTrials.gov (NCT00531193) Using PET Scans to Study Brain Receptor Occupancy of BIIB014 in Healthy Male Volunteers. U.S. National Institutes of Health.
Ref 522369ClinicalTrials.gov (NCT00709865) Phase 2b Study to Assess the Safety and Tolerability of IV Tonapofylline in Subjects With Acute Decompensated Heart Failure (ADHF) and Renal Insufficiency. U.S. National Institutes of Health.
Ref 522738ClinicalTrials.gov (NCT00944970) Efficacy and Safety Study of Binodenoson in Assessing Cardiac Ischemia. U.S. National Institutes of Health.
Ref 522811ClinicalTrials.gov (NCT00990327) Study of the Safety and Efficacy of Apadenoson for Detection of Myocardial Perfusion Defects Using SPECT MPI. U.S. National Institutes of Health.
Ref 523322ClinicalTrials.gov (NCT01279083) Safety and Efficacy Trial to Treat Open-Angle Glaucoma or Ocular Hypertension. U.S. National Institutes of Health.
Ref 523581ClinicalTrials.gov (NCT01410188) Safety/Efficacy Study: OPA-6566 Ophthalmic Solution in Subjects With Primary Open-Angle Glaucoma or Ocular Hypertension. U.S. National Institutes of Health.
Ref 523974ClinicalTrials.gov (NCT01640990) A Study to Assess the Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of an Intravenous Infusion of GW328267X in Healthy Volunteers. U.S. National Institutes of Health.
Ref 524937ClinicalTrials.gov (NCT02253745) Safety, Tolerability, PK & Efficacy of V81444 in Volunteers With Attention Deficit/ Hyperactivity Disorder (ADHD). U.S. National Institutes of Health.
Ref 525212ClinicalTrials.gov (NCT02453386) Safety and Efficacy Study of Tozadenant to Treat End of Dose Wearing Off in Parkinson's Patients Using Levodopa.
Ref 526560Effects of the alpha 2-adrenoreceptor antagonist dexefaroxan on neurogenesis in the olfactory bulb of the adult rat in vivo: selective protection against neuronal death. Neuroscience. 2003;117(2):281-91.
Ref 5299412008 FDA drug approvals. Nat Rev Drug Discov. 2009 Feb;8(2):93-6.
Ref 536285Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54.
Ref 536297Emerging drugs for diabetic foot ulcers. Expert Opin Emerg Drugs. 2006 Nov;11(4):709-24.
Ref 536374Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
Ref 536463The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31.
Ref 536949Fatigue: an overview. Am Fam Physician. 2008 Nov 15;78(10):1173-9.
Ref 540246(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3283).
Ref 540254(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3290).
Ref 540510(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 375).
Ref 540649(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 405).
Ref 540664(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 407).
Ref 540962(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5594).
Ref 540963(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5595).
Ref 540964(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5596).
Ref 540973(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5605).
Ref 540980(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5611).
Ref 540981(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5612).
Ref 540983(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5614).
Ref 543123(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8420).
Ref 544253Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May; 1808(5): 1290-1308.
Ref 544564Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000147)
Ref 544778Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000987)
Ref 546031Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005980)
Ref 546100Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006356)
Ref 546171Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006749)
Ref 546315Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007402)
Ref 548203Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023039)
Ref 548653Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027391)
Ref 551079Clinical pipeline report, company report or official report of Kyowa Hakko Pharmaceuticals.
Ref 525562Bioorg Med Chem Lett. 1999 Jul 19;9(14):1979-84.Discovery of FR166124, a novel water-soluble pyrazolo-[1,5-a]pyridine adenosine A1 receptor antagonist.
Ref 525578J Med Chem. 1999 Sep 9;42(18):3463-77.N-substituted adenosines as novel neuroprotective A(1) agonists with diminished hypotensive effects.
Ref 525783J Med Chem. 2000 Jun 1;43(11):2196-203.Methanocarba analogues of purine nucleosides as potent and selective adenosine receptor agonists.
Ref 525917J Med Chem. 2000 Nov 16;43(23):4359-62.Design, radiosynthesis, and biodistribution of a new potent and selective ligand for in vivo imaging of the adenosine A(2A) receptor system using positron emission tomography.
Ref 526011J Med Chem. 2001 Mar 1;44(5):749-62.Thiazole and thiadiazole analogues as a novel class of adenosine receptor antagonists.
Ref 526104Bioorg Med Chem Lett. 2001 Jul 23;11(14):1931-4.Introduction of alkynyl chains on C-8 of adenosine led to very selective antagonists of the A(3) adenosine receptor.
Ref 526958J Med Chem. 2004 Feb 12;47(4):1031-43.Preparation, properties, reactions, and adenosine receptor affinities of sulfophenylxanthine nitrophenyl esters: toward the development of sulfonic acid prodrugswith peroral bioavailability.
Ref 527040J Med Chem. 2004 Apr 22;47(9):2243-55.Novel amino acid derived natural products from the ascidian Atriolum robustum: identification and pharmacological characterization of a unique adenosine derivative.
Ref 527055Bioorg Med Chem Lett. 2004 May 17;14(10):2443-6.Facile synthesis of fused 1,2,4-triazolo[1,5-c]pyrimidine derivatives as human adenosine A3 receptor ligands.
Ref 527148Adenosine A1/A2a receptor agonist AMP-579 induces acute and delayed preconditioning against in vivo myocardial stunning. Am J Physiol Heart Circ Physiol. 2004 Dec;287(6):H2746-53. Epub 2004 Jul 22.
Ref 527331J Med Chem. 2004 Dec 16;47(26):6529-40.2,4,6-trisubstituted pyrimidines as a new class of selective adenosine A1 receptor antagonists.
Ref 527503Bioorg Med Chem Lett. 2005 Apr 15;15(8):2119-22.6-(2-Furanyl)-9H-purin-2-amine derivatives as A2A adenosine antagonists.
Ref 527647J Med Chem. 2005 Jul 28;48(15):4910-8."Reversine" and its 2-substituted adenine derivatives as potent and selective A3 adenosine receptor antagonists.
Ref 527683Bioorg Med Chem Lett. 2005 Oct 15;15(20):4604-10.1,8-Naphthyridin-4-one derivatives as new ligands of A2A adenosine receptors.
Ref 527717J Med Chem. 1992 Jun 12;35(12):2342-5.(E)-1,3-dialkyl-7-methyl-8-(3,4,5-trimethoxystyryl)xanthines: potent and selective adenosine A2 antagonists.
Ref 527823J Med Chem. 2005 Nov 3;48(22):6887-96.2-n-Butyl-9-methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine and analogues as A2A adenosine receptor antagonists. Design, synthesis, and pharmacological characterization.
Ref 527933J Med Chem. 2005 Dec 29;48(26):8253-60.2-(Benzimidazol-2-yl)quinoxalines: a novel class of selective antagonists at human A(1) and A(3) adenosine receptors designed by 3D database searching.
Ref 528143Effect of novel A2A adenosine receptor agonist ATL 313 on Clostridium difficile toxin A-induced murine ileal enteritis. Infect Immun. 2006 May;74(5):2606-12.
Ref 528192J Med Chem. 2006 May 18;49(10):2861-7.2,6-disubstituted and 2,6,8-trisubstituted purines as adenosine receptor antagonists.
Ref 528434Bioorg Med Chem Lett. 2006 Dec 1;16(23):5993-7. Epub 2006 Sep 12.Identification of non-furan containing A2A antagonists using database mining and molecular similarity approaches.
Ref 528544J Med Chem. 2006 Nov 30;49(24):7119-31.Potent and orally bioavailable 8-bicyclo[2.2.2]octylxanthines as adenosine A1 receptor antagonists.
Ref 528673J Med Chem. 2007 Feb 22;50(4):828-34.2,6,8-trisubstituted 1-deazapurines as adenosine receptor antagonists.
Ref 528684J Med Chem. 2007 Mar 22;50(6):1222-30. Epub 2007 Feb 20.N6-methoxy-2-alkynyladenosine derivatives as highly potent and selective ligands at the human A3 adenosine receptor.
Ref 528748J Med Chem. 2007 Apr 19;50(8):1810-27. Epub 2007 Mar 23.Structure-activity relationships of 2,N(6),5'-substituted adenosine derivatives with potent activity at the A2B adenosine receptor.
Ref 528752J Nat Prod. 2007 Apr;70(4):571-4. Epub 2007 Mar 24.Neuroprotective principles from Gastrodia elata.
Ref 528865Coronary circulation responses to binodenoson, a selective adenosine A2A receptor agonist. Am J Cardiol. 2007 Jun 1;99(11):1507-12. Epub 2007 Apr 16.
Ref 528969J Med Chem. 2007 Aug 23;50(17):4061-74. Epub 2007 Aug 1.New 2-arylpyrazolo[3,4-c]quinoline derivatives as potent and selective human A3 adenosine receptor antagonists. Synthesis, pharmacological evaluation, and ligand-receptor modeling studies.
Ref 529098Bioorg Med Chem. 2008 Jan 1;16(1):336-53. Epub 2007 Sep 22.5'-Carbamoyl derivatives of 2'-C-methyl-purine nucleosides as selective A1 adenosine receptor agonists: affinity, efficacy, and selectivityfor A1 receptor from different species.
Ref 529183Eur J Med Chem. 2008 Aug;43(8):1639-47. Epub 2007 Oct 24.N6-1,3-diphenylurea derivatives of 2-phenyl-9-benzyladenines and 8-azaadenines: synthesis and biological evaluation as allosteric modulators of A2A adenosine receptors.
Ref 529255J Med Chem. 2008 Feb 14;51(3):400-6. Epub 2008 Jan 12.Identification of novel, water-soluble, 2-amino-N-pyrimidin-4-yl acetamides as A2A receptor antagonists with in vivo efficacy.
Ref 529299Bioorg Med Chem. 2008 Mar 15;16(6):2741-52. Epub 2008 Jan 12.A new generation of adenosine receptor antagonists: from di- to trisubstituted aminopyrimidines.
Ref 529305Bioorg Med Chem. 2008 Apr 1;16(7):3825-30. Epub 2008 Jan 30.Synthesis of eudistomin D analogues and its effects on adenosine receptors.
Ref 529313J Med Chem. 2008 Mar 27;51(6):1764-70. Epub 2008 Feb 13.Derivatives of 4-amino-6-hydroxy-2-mercaptopyrimidine as novel, potent, and selective A3 adenosine receptor antagonists.
Ref 529418Bioorg Med Chem Lett. 2008 May 1;18(9):2916-9. Epub 2008 Mar 30.Antagonists of the human adenosine A2A receptor. Part 1: Discovery and synthesis of thieno[3,2-d]pyrimidine-4-methanone derivatives.
Ref 529419Bioorg Med Chem Lett. 2008 May 1;18(9):2920-3. Epub 2008 Mar 30.Antagonists of the human adenosine A2A receptor. Part 2: Design and synthesis of 4-arylthieno[3,2-d]pyrimidine derivatives.
Ref 529421Bioorg Med Chem Lett. 2008 May 1;18(9):2924-9. Epub 2008 Mar 30.Antagonists of the human adenosine A2A receptor. Part 3: Design and synthesis of pyrazolo[3,4-d]pyrimidines, pyrrolo[2,3-d]pyrimidinesand 6-arylpurines.
Ref 529602J Med Chem. 2008 Aug 14;51(15):4449-55. Epub 2008 Jul 19.2-Amino-6-furan-2-yl-4-substituted nicotinonitriles as A2A adenosine receptor antagonists.
Ref 529653Bioorg Med Chem. 2008 Sep 15;16(18):8676-84. Epub 2008 Aug 5.Dual inhibition of monoamine oxidase B and antagonism of the adenosine A(2A) receptor by (E,E)-8-(4-phenylbutadien-1-yl)caffeine analogues.
Ref 529858J Med Chem. 2009 Jan 8;52(1):33-47.Antagonists of the human A(2A) adenosine receptor. 4. Design, synthesis, and preclinical evaluation of 7-aryltriazolo[4,5-d]pyrimidines.
Ref 530014Bioorg Med Chem. 2009 Apr 1;17(7):2812-22. Epub 2009 Feb 23.8-Bromo-9-alkyl adenine derivatives as tools for developing new adenosine A2A and A2B receptors ligands.
Ref 530035J Med Chem. 2009 Apr 23;52(8):2393-406.N6-Cycloalkyl- and N6-bicycloalkyl-C5'(C2')-modified adenosine derivatives as high-affinity and selective agonists at the human A1 adenosine receptor with antinociceptive effects in mice.
Ref 530243J Med Chem. 2009 Jul 9;52(13):3994-4006.1-alkyl-8-(piperazine-1-sulfonyl)phenylxanthines: development and characterization of adenosine A2B receptor antagonists and a new radioligand with subnanomolar affinity and subtype specificity.
Ref 530372J Med Chem. 2009 Dec 10;52(23):7640-52.2-Phenylpyrazolo[4,3-d]pyrimidin-7-one as a new scaffold to obtain potent and selective human A3 adenosine receptor antagonists: new insights into the receptor-antagonist recognition.
Ref 530590J Med Chem. 1991 Mar;34(3):1202-6.1H-imidazo[4,5-c]quinolin-4-amines: novel non-xanthine adenosine antagonists.
Ref 530599Bioorg Med Chem Lett. 2010 Feb 1;20(3):1090-3. Epub 2009 Dec 11.Synthetic studies on selective adenosine A2A receptor antagonists: synthesis and structure-activity relationships of novel benzofuran derivatives.
Ref 530650J Med Chem. 2010 Feb 25;53(4):1799-809.Structure-based discovery of novel chemotypes for adenosine A(2A) receptor antagonists.
Ref 530672Eur J Med Chem. 2010 May;45(5):1739-45. Epub 2010 Jan 14.Synthesis and theoretical studies on energetics of novel N- and O- perfluoroalkyl triazole tagged thienopyrimidines--their potential as adenosine receptor ligands.
Ref 530694Bioorg Med Chem Lett. 2010 Mar 1;20(5):1697-700. Epub 2010 Jan 20.Discovery of N-(5,6-diarylpyridin-2-yl)amide derivatives as potent and selective A(2B) adenosine receptor antagonists.
Ref 530752Bioorg Med Chem. 2010 Mar 15;18(6):2195-203. Epub 2010 Feb 4.2-Amino-5-benzoyl-4-phenylthiazoles: Development of potent and selective adenosine A1 receptor antagonists.
Ref 530966Eur J Med Chem. 2010 Aug;45(8):3459-71. Epub 2010 May 7.Insights into binding modes of adenosine A(2B) antagonists with ligand-based and receptor-based methods.
Ref 531079J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential.
Ref 531316Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May;1808(5):1290-308.
Ref 531387Structure of an agonist-bound human A2A adenosine receptor. Science. 2011 Apr 15;332(6027):322-7.
Ref 531680The novel adenosine A2A antagonist Lu AA47070 reverses the motor and motivational effects produced by dopamine D2 receptor blockade. Pharmacol Biochem Behav. 2012 Jan;100(3):498-505.
Ref 532726Adenosine A2A receptor antagonists in Parkinson's disease: progress in clinical trials from the newly approved istradefylline to drugs in early development and those already discontinued. CNS Drugs. 2014 May;28(5):455-74.
Ref 532878Tozadenant (SYN115) in patients with Parkinson's disease who have motor fluctuations on levodopa: a phase 2b, double-blind, randomised trial. Lancet Neurol. 2014 Aug;13(8):767-76.
Ref 533394J Med Chem. 1985 Apr;28(4):487-92.1,3-Dialkyl-8-(p-sulfophenyl)xanthines: potent water-soluble antagonists for A1- and A2-adenosine receptors.
Ref 533429J Med Chem. 1988 Oct;31(10):2034-9.Benzo[1,2-c:5,4-c']dipyrazoles: non-xanthine adenosine antagonists.
Ref 533449J Med Chem. 1988 Jun;31(6):1179-83.Adenosine receptor agonists: synthesis and biological evaluation of 1-deaza analogues of adenosine derivatives.
Ref 533486J Med Chem. 1986 Jul;29(7):1305-8.Analogues of caffeine and theophylline: effect of structural alterations on affinity at adenosine receptors.
Ref 533722J Med Chem. 1995 May 12;38(10):1720-35.Structure-activity relationships of 9-alkyladenine and ribose-modified adenosine derivatives at rat A3 adenosine receptors.
Ref 533955J Med Chem. 1993 Nov 12;36(23):3731-3.Photoisomerization of a potent and selective adenosine A2 antagonist, (E)-1,3-Dipropyl-8-(3,4-dimethoxystyryl)-7-methylxanthine.
Ref 534439J Med Chem. 1997 Aug 1;40(16):2588-95.Mutagenesis reveals structure-activity parallels between human A2A adenosine receptors and biogenic amine G protein-coupled receptors.
Ref 534583J Nat Prod. 1998 Feb;61(2):301-5.Bioactive pyridoacridine alkaloids from the micronesian sponge Oceanapia sp.
Ref 534646J Med Chem. 1998 Jun 4;41(12):2126-33.Design, synthesis, and biological evaluation of a second generation of pyrazolo[4,3-e]-1,2,4-triazolo[1,5-c]pyrimidines as potent and selective A2A adenosine receptor antagonists.
Ref 535245Adenosine A2A receptor antagonists are potential antidepressants: evidence based on pharmacology and A2A receptor knockout mice. Br J Pharmacol. 2001 Sep;134(1):68-77.
Ref 535415Effects of CGS 21680, a selective adenosine A2A receptor agonist, on allergic airways inflammation in the rat. Eur J Pharmacol. 2002 Mar 8;438(3):183-8.
Ref 535757Blockade of A2A adenosine receptors prevents basic fibroblast growth factor-induced reactive astrogliosis in rat striatal primary astrocytes. Glia. 2003 Aug;43(2):190-4.
Ref 535951Caffeine as a psychomotor stimulant: mechanism of action. Cell Mol Life Sci. 2004 Apr;61(7-8):857-72.
Ref 536285Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54.
Ref 536297Emerging drugs for diabetic foot ulcers. Expert Opin Emerg Drugs. 2006 Nov;11(4):709-24.
Ref 536302Adenosine receptor antagonists intensify the benzodiazepine withdrawal signs in mice. Pharmacol Rep. 2006 Sep-Oct;58(5):643-51.
Ref 536374Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
Ref 536463The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31.
Ref 540254(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3290).
Ref 540978(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5610).
Ref 550203Clinical pipeline report, company report or official report of Acucela.
Ref 551229High selectivity of novel isoguanosine analogues for the adenosine A1 receptor. Bioorg. Med. Chem. Lett. 1(9):481-486 (1991).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.