Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T32348 | Target Info | |||
Target Name | Early growth response protein 1 (EGR-1) | ||||
Synonyms | Zinc finger protein Krox24; Zinc finger protein Krox-24; Zinc finger protein 225; ZNF225; Transcription factor Zif268; Transcription factor ETR103; Nerve growth factorinduced protein A; Nerve growth factor-induced protein A; NGFIA; NGFI-A; KROX24; AT225 | ||||
Target Type | Clinical trial Target | ||||
Gene Name | EGR1 | ||||
Biochemical Class | EGR C2H2-type zinc-finger | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | cAMP-responsive element-binding (CREB) homodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Leucine zipper factors (bZIP) | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Electrophoretic mobility shift assays performed with CREB antibody confirmed the presence of CREB in the DNA-binding complex of the EGR1 gene. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
UniProt ID | |||||
Sequence |
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apoptosis regulators | [+] 1 Apoptosis regulators Co-regulated By This TF | + | |||
Cytokines / Cytokine receptors | [+] 3 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Fibronectin proteins | [+] 1 Fibronectin proteins Co-regulated By This TF | + | |||
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
Glucagons | [+] 1 Glucagons Co-regulated By This TF | + | |||
Hormones | [+] 2 Hormones Co-regulated By This TF | + | |||
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
Oxidoreductases | [+] 2 Oxidoreductases Co-regulated By This TF | + | |||
Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + | |||
Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
TF Name | Early growth response protein 1 (EGR1) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys2His2 zinc finger domain | ||||
Family | Developmental / cell cycle regulators | ||||
Subfamily | Egr/Krox | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | The EGR1 protein may further stimulate transcription of the EGR1 gene in response to GM-CSF as a secondary event. | [1] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI EIC |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
Growth factors | [+] 2 Growth factors Co-regulated By This TF | + | |||
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
Kinases | [+] 1 Kinases Co-regulated By This TF | + | |||
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
Transcription factors | [+] 2 Transcription factors Co-regulated By This TF | + | |||
TF Name | Serum response factor (SRF) homodimer | ||||
Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
Class | MADS box | ||||
Family | Responders to external signals | ||||
Regulation Mechanism | Transient transfections of NFS60 cells with recombinant constructs containing various deletions of the human EGR1 promoter identified the SRE between nucleotides (nt) -418 and -391 as a critical G-CSF-responsive sequence. The SRE contains a CArG box, the binding site for the SRF. | [2] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREA
AAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAA TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG TQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG FEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAV IGQQAGSSSNLTELQVVNLDTAHSTKSE |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apoptosis regulators | [+] 1 Apoptosis regulators Co-regulated By This TF | + | |||
Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Granulocyte-macrophage colony-stimulating factor and interleukin-3 signaling pathways converge on the CREB-binding site in the human egr-1 promoter. Mol Cell Biol. 1994 Sep;14(9):5975-85. | ||||
REF 2 | Granulocyte colony-stimulating factor induces Egr-1 up-regulation through interaction of serum response element-binding proteins. J Biol Chem. 2000 Jul 21;275(29):22418-26. | ||||
REF 3 | Mechanism of transcriptional activation of the immediate early gene Egr-1 in response to PIXY321. Blood. 1996 Aug 1;88(3):848-54. | ||||
REF 4 | Induction of bcl-2 expression by phosphorylated CREB proteins during B-cell activation and rescue from apoptosis. Mol Cell Biol. 1996 Oct;16(10):5546-56. | ||||
REF 5 | The proximal regulatory element of the interferon-gamma promoter mediates selective expression in T cells. J Biol Chem. 1996 Dec 13;271(50):31964-72. | ||||
REF 6 | An AP-1 site in the promoter of the human IL-5R alpha gene is necessary for promoter activity in eosinophilic HL60 cells. FEBS Lett. 1998 Sep 4;434(3):251-4. | ||||
REF 7 | Transcription factors NF-IL6 and CREB recognize a common essential site in the human prointerleukin 1 beta gene. Mol Cell Biol. 1994 Nov;14(11):7285-97. | ||||
REF 8 | Cyclic AMP inhibits fibronectin gene expression in a newly developed granulosa cell line by a mechanism that suppresses cAMP-responsive element-dependent transcriptional activation. J Biol Chem. 1990 Oct 25;265(30):18219-26. | ||||
REF 9 | Functional mapping of a placenta-specific upstream promoter for human gonadotropin-releasing hormone receptor gene. Endocrinology. 2001 Apr;142(4):1506-16. | ||||
REF 10 | Cyclic AMP- and phorbol ester-induced transcriptional activation are mediated by the same enhancer element in the human vasoactive intestinal peptide gene. J Biol Chem. 1991 Feb 25;266(6):3882-7. | ||||
REF 11 | The transcription factors ATF-1 and CREB-1 bind constitutively to the hypoxia-inducible factor-1 (HIF-1) DNA recognition site. Nucleic Acids Res. 1995 Nov 25;23(22):4542-50. | ||||
REF 12 | A redox factor protein, ref1, is involved in negative gene regulation by extracellular calcium. J Biol Chem. 1994 Nov 11;269(45):27855-62. | ||||
REF 13 | CD4 promoter transactivation by human herpesvirus 6. J Virol. 1998 Nov;72(11):8797-805. | ||||
REF 14 | Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21. | ||||
REF 15 | Regulatory mechanisms of cAMP-dependent and cell-specific expression of human steroidogenic cytochrome P450scc (CYP11A1) gene. Eur J Biochem. 1994 Jun 15;222(3):825-34. | ||||
REF 16 | Noradrenergic-specific transcription of the dopamine beta-hydroxylase gene requires synergy of multiple cis-acting elements including at least two Phox2a-binding sites. J Neurosci. 1998 Oct 15;18(20):8247-60. | ||||
REF 17 | Differential binding of cAMP-responsive-element (CRE)-binding protein-1 and activating transcription factor-2 to a CRE-like element in the human tissue-type plasminogen activator (t-PA) gene promoter correlates with opposite regulation of t-PA by phorbol ester in HT-1080 and HeLa cells. Eur J Biochem. 1996 May 1;237(3):532-8. | ||||
REF 18 | Brain-specific expression of the human transferrin gene. Similar elements govern transcription in oligodendrocytes and in a neuronal cell line. J Biol Chem. 1994 Sep 30;269(39):24504-10. | ||||
REF 19 | Involvement of early growth response factor Egr-1 in apolipoprotein AI gene transcription. J Biol Chem. 1995 Mar 24;270(12):7004-10. | ||||
REF 20 | The Wilms' tumor gene product, WT1, represses transcription of the platelet-derived growth factor A-chain gene. J Biol Chem. 1992 Nov 5;267(31):21999-2002. | ||||
REF 21 | c-sis/PDGF-B promoter transactivation by the Yax protein of human T-cell leukemia virus type 1. J Biol Chem. 1996 Jun 14;271(24):14584-90. | ||||
REF 22 | In vivo footprinting and mutational analysis of the proximal CD19 promoter reveal important roles for an SP1/Egr-1 binding site and a novel site termed the PyG box. J Immunol. 1997 Aug 1;159(3):1284-92. | ||||
REF 23 | Early Growth Response-1 gene mediates up-regulation of epidermal growth factor receptor expression during hypoxia. Cancer Res. 2002 Feb 1;62(3):827-34. | ||||
REF 24 | The human copper-zinc superoxide dismutase gene (SOD1) proximal promoter is regulated by Sp1, Egr-1, and WT1 via non-canonical binding sites. J Biol Chem. 1999 Jan 1;274(1):503-9. | ||||
REF 25 | Early growth response-1-dependent apoptosis is mediated by p53. J Biol Chem. 1997 Aug 8;272(32):20131-8. | ||||
REF 26 | Regulation of MCL1 through a serum response factor/Elk-1-mediated mechanism links expression of a viability-promoting member of the BCL2 family to the induction of hematopoietic cell differentiation. J Biol Chem. 1999 Jan 15;274(3):1801-13. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.