Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T75655 | Target Info | |||
Target Name | Apolipoprotein A-II (APOA2) | ||||
Synonyms | Apolipoprotein A2; ApoA-II; Apo-AII | ||||
Target Type | Literature-reported Target | ||||
Gene Name | APOA2 | ||||
Biochemical Class | Apolipoprotein | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | C/EBP alpha (CEBPA) homodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Leucine zipper factors (bZIP) | ||||
Family | C/EBP-like factors | ||||
Regulation Mechanism | Region AB of the APOA2 gene binds purified C/EBP produced by expression of C/EBP cDNA in bacteria. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
UniProt ID | |||||
Sequence |
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 3 Apolipoproteins Co-regulated By This TF | + | |||
Calcium-binding proteins | [+] 1 Calcium-binding proteins Co-regulated By This TF | + | |||
Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Glycoproteins | [+] 1 Glycoproteins Co-regulated By This TF | + | |||
Integrins | [+] 1 Integrins Co-regulated By This TF | + | |||
Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
Somatotropin / Prolactins | [+] 1 Somatotropin / Prolactins Co-regulated By This TF | + | |||
Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
TF Name | USF1/USF2 (USF) heterodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Helix-loop-helix / leucine zipper factors (bHLH-ZIP) | ||||
Family | upstream stimulatory factor | ||||
Regulation Type | Increase | ||||
Evidence Score (E-score) | 2 | + | |||
UniProt ID | |||||
Sequence |
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP STAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAP RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG LEVVIKNDSN |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
TF Name | Hepatocyte nuclear factor 4-alpha (HNF-4A) homodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Hepatocyte nuclear factor 4 | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | The APOA2 promoter construct contained the same promoter region with an internal deletion of the element J (-740 to -719) which is the binding site for NF-BA1, HNF-4, ARP-1, EAR-2, and EAR-3. | [2] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
Nuclear hormone receptors | [+] 1 Nuclear hormone receptors Co-regulated By This TF | + | |||
Oxidoreductases | [+] 2 Oxidoreductases Co-regulated By This TF | + | |||
Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
Serpin proteins | [+] 1 Serpin proteins Co-regulated By This TF | + | |||
Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
TF Name | Retinoid X receptor alpha (RXR-A) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Retinoid X receptors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Transient-transfection experiments with a reporter construct driven by the human APOA2gene promoter indicated that 9-cis RA and at-RA, as well as theRXRagonists LGD 1069 and LG 100268, induced APOA2 gene expression at the transcriptional level.. | [3] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Acyltransferases | [+] 1 Acyltransferases Co-regulated By This TF | + | |||
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
Ester hydrolases | [+] 1 Ester hydrolases Co-regulated By This TF | + | |||
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
Glycoproteins | [+] 2 Glycoproteins Co-regulated By This TF | + | |||
Kinases | [+] 1 Kinases Co-regulated By This TF | + | |||
Mitochondrial carriers | [+] 1 Mitochondrial carriers Co-regulated By This TF | + | |||
Nuclear hormone receptors | [+] 4 Nuclear hormone receptors Co-regulated By This TF | + | |||
TF Name | COUP transcription factor 1 (COUP-TF1) homodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Regulation Type | Decrease | ||||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGA
PATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTY TCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLN GHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF PDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIR IFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQY PNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSI QCS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
TF Name | COUP transcription factor 2 (COUP-TF2) homodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Regulation Type | Decrease | ||||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
Glycoproteins | [+] 1 Glycoproteins Co-regulated By This TF | + | |||
Nuclear hormone receptors | [+] 1 Nuclear hormone receptors Co-regulated By This TF | + | |||
TF Name | RXR-alpha/RAR-alpha (RXRA/RARA) heterodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Transient-transfection experiments with a reporter construct driven by the human APOA2gene promoter indicated that 9-cis RA and at-RA, as well as theRXRagonists LGD 1069 and LG 100268, induced APOA2 gene expression at the transcriptional level.. | [3] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
Growth factors | [+] 1 Growth factors Co-regulated By This TF | + | |||
TF Name | Upstream stimulatory factor 2 (USF2) homodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Helix-loop-helix / leucine zipper factors (bHLH-ZIP) | ||||
Family | Upstream stimulatory factor | ||||
Regulation Mechanism | Cotransfection experiments in HepG2 cells established the functional significance of USF in APOA2 transcription. It was found that the minimal promoter AB was transactivated by USF2a. | [4] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFG
DHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVD GAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTA VSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQH NEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQET FKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 2 Apolipoproteins Co-regulated By This TF | + | |||
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Regulation of the human ApoA-II gene by the synergistic action of factors binding to the proximal and distal regulatory elements. J Biol Chem. 1991 Dec 25;266(36):24460-70. | ||||
REF 2 | Transcriptional regulation of human apolipoprotein genes ApoB, ApoCIII, and ApoAII by members of the steroid hormone receptor superfamily HNF-4, AR... J Biol Chem. 1992 Aug 5;267(22):15849-60. | ||||
REF 3 | Retinoids increase human apolipoprotein A-11 expression through activation of the retinoid X receptor but not the retinoic acid receptor. Mol Cell Biol. 1996 Jul;16(7):3350-60. | ||||
REF 4 | Cooperative binding of upstream stimulatory factor and hepatic nuclear factor 4 drives the transcription of the human apolipoprotein A-II gene. J Biol Chem. 1999 Jan 15;274(3):1216-25. | ||||
REF 5 | Factors participating in the liver-specific expression of the human apolipoprotein A-II gene and their significance for transcription. Biochemistry. 1993 Sep 7;32(35):9080-93. | ||||
REF 6 | Identification and characterization of a 315-base pair enhancer, located more than 55 kilobases 5' of the apolipoprotein B gene, that confers expression in the intestine. J Biol Chem. 2000 Aug 25;275(34):26637-48. | ||||
REF 7 | Structure of the hepatic control region of the human apolipoprotein E/C-I gene locus. J Biol Chem. 1995 Sep 22;270(38):22577-85. | ||||
REF 8 | Transcriptional regulation by C/EBP alpha and -beta in the expression of the gene for the MRP14 myeloid calcium binding protein. Cell Struct Funct. 1998 Jun;23(3):109-18. | ||||
REF 9 | Role of the liver-enriched transcription factor hepatocyte nuclear factor 1 in transcriptional regulation of the factor V111 gene. Mol Cell Biol. 1996 May;16(5):1936-45. | ||||
REF 10 | PU.1 (Spi-1) and C/EBP alpha regulate the granulocyte colony-stimulating factor receptor promoter in myeloid cells. Blood. 1996 Aug 15;88(4):1234-47. | ||||
REF 11 | The CCAAT/enhancer-binding protein trans-activates the human cholesteryl ester transfer protein gene promoter. J Biol Chem. 1992 Nov 5;267(31):22336-9. | ||||
REF 12 | The alpha2 and alpha5 integrin genes: identification of transcription factors that regulate promoter activity in epidermal keratinocytes. FEBS Lett. 2000 Jun 2;474(2-3):201-7. | ||||
REF 13 | Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21. | ||||
REF 14 | The role of CCAAT/enhancer-binding protein in the differential transcriptional regulation of a family of human liver alcohol dehydrogenase genes. J Biol Chem. 1991 Jun 25;266(18):11594-603. | ||||
REF 15 | Binding of the Ets factor GA-binding protein to an upstream site in the factor IX promoter is a critical event in transactivation. Mol Cell Biol. 1996 May;16(5):1929-35. | ||||
REF 16 | CCAAT/enhancer-binding proteins are mediators in the protein kinase A-dependent activation of the decidual prolactin promoter. J Biol Chem. 1999 Aug 27;274(35):24808-18. | ||||
REF 17 | A different combination of transcription factors modulates the expression of the human transferrin promoter in liver and Sertoli cells. J Biol Chem. 1993 Nov 5;268(31):23399-408. | ||||
REF 18 | Modulation of transcriptional activation and coactivator interaction by a splicing variation in the F domain of nuclear receptor hepatocyte nuclear factor 4alpha1. Mol Cell Biol. 1999 Oct;19(10):6509-22. | ||||
REF 19 | Mitogen-activated protein kinase regulates transcription of the ApoCIII gene. Involvement of the orphan nuclear receptor HNF4. J Biol Chem. 1999 Nov 12;274(46):33050-6. | ||||
REF 20 | cis-acting elements and transcription factors involved in the promoter activity of the human factor VIII gene. J Biol Chem. 1995 May 19;270(20):11828-38. | ||||
REF 21 | The orphan receptor hepatic nuclear factor 4 functions as a transcriptional activator for tissue-specific and hypoxia-specific erythropoietin gene expression and is antagonized by EAR3/COUP-TF1. Mol Cell Biol. 1995 Apr;15(4):2135-44. | ||||
REF 22 | Regulatory mechanisms controlling human hepatocyte nuclear factor 4alpha gene expression. Mol Cell Biol. 2001 Nov;21(21):7320-30. | ||||
REF 23 | Characterization of the human cytochrome P4502D6 promoter. A potential role for antagonistic interactions between members of the nuclear receptor family. J Biol Chem. 1996 Oct 11;271(41):25269-76. | ||||
REF 24 | Co-operation of the transcription factor hepatocyte nuclear factor-4 with Sp1 or Sp3 leads to transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line. Biochem J. 2002 Nov 1;367(Pt 3):641-52. | ||||
REF 25 | Disruption of a C/EBP binding site in the factor IX promoter is associated with haemophilia B. Nature. 1990 May 31;345(6274):444-6. | ||||
REF 26 | Regulated expression of human angiotensinogen gene by hepatocyte nuclear factor 4 and chicken ovalbumin upstream promoter-transcription factor. J Biol Chem. 1999 Dec 3;274(49):34605-12. | ||||
REF 27 | Co-regulation of tissue-specific alternative human carnitine palmitoyltransferase Ibeta gene promoters by fatty acid enzyme substrate. J Biol Chem. 1998 Dec 4;273(49):32901-9. | ||||
REF 28 | Bile acid-activated nuclear receptor FXR suppresses apolipoprotein A-I transcription via a negative FXR response element. J Clin Invest. 2002 Apr;109(7):961-71. | ||||
REF 29 | Mode of action of peroxisome proliferators as hypolipidemic drugs. Suppression of apolipoprotein C-III. J Biol Chem. 1995 Jun 2;270(22):13470-5. | ||||
REF 30 | LXRs control lipid-inducible expression of the apolipoprotein E gene in macrophages and adipocytes. Proc Natl Acad Sci U S A. 2001 Jan 16;98(2):507-12. | ||||
REF 31 | PPARalpha and PPARgamma activators direct a distinct tissue-specific transcriptional response via a PPRE in the lipoprotein lipase gene. EMBO J. 1996 Oct 1;15(19):5336-48. | ||||
REF 32 | Human calcium-sensing receptor gene. Vitamin D response elements in promoters P1 and P2 confer transcriptional responsiveness to 1,25-dihydroxyvitamin D. J Biol Chem. 2002 Aug 16;277(33):30337-50. | ||||
REF 33 | The orphan nuclear receptor LRH-1 potentiates the sterol-mediated induction of the human CETP gene by liver X receptor. J Biol Chem. 2001 Jul 6;276(27):24767-73. | ||||
REF 34 | The farnesoid X-activated receptor mediates bile acid activation of phospholipid transfer protein gene expression. J Biol Chem. 2000 Dec 15;275(50):39313-7. | ||||
REF 35 | T3 receptor suppression of Sp1-dependent transcription from the epidermal growth factor receptor promoter via overlapping DNA-binding sites. J Biol Chem. 1993 Jul 25;268(21):16065-73. | ||||
REF 36 | The human uncoupling protein-3 gene promoter requires MyoD and is induced by retinoic acid in muscle cells. FASEB J. 2000 Nov;14(14):2141-3. | ||||
REF 37 | Vitamin D represses retinoic acid-dependent transactivation of the retinoic acid receptor-beta2 promoter: the AF-2 domain of the vitamin D receptor is required for transrepression. Endocrinology. 1999 Jun;140(6):2898-907. | ||||
REF 38 | RAR gamma 2 expression is regulated through a retinoic acid response element embedded in Sp1 sites. Mol Cell Biol. 1992 Jul;12(7):2976-85. | ||||
REF 39 | Identification of thyroid hormone response elements in the human fatty acid synthase promoter. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12260-5. | ||||
REF 40 | COUP orphan receptors are negative regulators of retinoic acid response pathways. Mol Cell Biol. 1992 Oct;12(10):4666-76. | ||||
REF 41 | Transcriptional regulation of the apolipoprotein B100 gene: purification and characterization of trans-acting factor BRF-2. Mol Cell Biol. 1992 Jul;12(7):3183-91. | ||||
REF 42 | Antagonism between apolipoprotein AI regulatory protein 1, Ear3/COUP-TF, and hepatocyte nuclear factor 4 modulates apolipoprotein CIII gene expression in liver and intestinal cells. Mol Cell Biol. 1992 Apr;12(4):1708-18. | ||||
REF 43 | Intestinal apolipoprotein AI gene transcription is regulated by multiple distinct DNA elements and is synergistically activated by the orphan nuclear receptor, hepatocyte nuclear factor 4. J Clin Invest. 1995 Jul;96(1):528-38. | ||||
REF 44 | Transcriptional regulation of the cholesteryl ester transfer protein gene by the orphan nuclear hormone receptor apolipoprotein AI regulatory protein-1. J Biol Chem. 1995 Dec 15;270(50):29916-22. | ||||
REF 45 | Acceleration of thrombomodulin gene transcription by retinoic acid: retinoic acid receptors and Sp1 regulate the promoter activity through interactions with two different sequences in the 5'-flanking region of human gene. J Biol Chem. 2001 Jan 26;276(4):2440-50. | ||||
REF 46 | Two initiator-like elements are required for the combined activation of the human apolipoprotein C-III promoter by upstream stimulatory factor and ... J Biol Chem. 2002 Apr 26;277(17):15199-206. | ||||
REF 47 | USF/c-Myc enhances, while Yin-Yang 1 suppresses, the promoter activity of CXCR4, a coreceptor for HIV-1 entry. J Immunol. 1999 May 15;162(10):5986-92. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.