Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T75655 Target Info
Target Name Apolipoprotein A-II (APOA2)
Synonyms Apolipoprotein A2; ApoA-II; Apo-AII
Target Type Literature-reported Target
Gene Name APOA2
Biochemical Class Apolipoprotein
UniProt ID
APOA2_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name C/EBP alpha (CEBPA) homodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Family C/EBP-like factors
Regulation Mechanism Region AB of the APOA2 gene binds purified C/EBP produced by expression of C/EBP cDNA in bacteria. [1]
Evidence Score (E-score) 2 +
1 DNA Binding Assay [5]
2 Electrophoretic Mobility Shift Assay [1]
UniProt ID
CEBPA_HUMAN
Sequence
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM
PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP
YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA
LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR
DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 3 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [1]
2 Apolipoprotein B-100 (APOB) Clinical trial Target Target Info [6]
3 Apolipoprotein E (APOE) Clinical trial Target Target Info [7]
Calcium-binding proteins [+] 1 Calcium-binding proteins Co-regulated By This TF +
1 Calgranulin B (S100A9) Clinical trial Target Target Info [8]
Coagulation factors [+] 1 Coagulation factors Co-regulated By This TF +
1 Coagulation factor VIII (F8) Successful Target Target Info [9]
Cytokines / Cytokine receptors [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Granulocyte colony-stimulating factor receptor (G-CSF-R) Successful Target Target Info [10]
Glycoproteins [+] 1 Glycoproteins Co-regulated By This TF +
1 Cholesteryl ester transfer protein (CETP) Clinical trial Target Target Info [11]
Integrins [+] 1 Integrins Co-regulated By This TF +
1 Integrin alpha-2 (ITGA2) Clinical trial Target Target Info [12]
Lipoprotein receptors [+] 1 Lipoprotein receptors Co-regulated By This TF +
1 Low-density lipoprotein receptor (LDL-R) Successful Target Target Info [13]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Entamoeba Alcohol dehydrogenase 2 (Entamo ADH2) Literature-reported Target Target Info [14]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Coagulation factor IX (F9) Successful Target Target Info [15]
Somatotropin / Prolactins [+] 1 Somatotropin / Prolactins Co-regulated By This TF +
1 Prolactin (PRL) Discontinued Target Target Info [16]
Transferrins [+] 1 Transferrins Co-regulated By This TF +
1 Transferrin (TF) Clinical trial Target Target Info [17]
TF Name USF1/USF2 (USF) heterodimer
Classification Superclass Basic Domains
Class Helix-loop-helix / leucine zipper factors (bHLH-ZIP)
Family upstream stimulatory factor
Regulation Type Increase
Evidence Score (E-score) 2 +
1 Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay [4]
2 Electrophoretic Mobility Shift Assay [1]
UniProt ID
USF1_HUMAN/USF2_HUMAN
Sequence
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP
STAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAP
RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK
GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG
LEVVIKNDSN
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 1 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [1]
TF Name Hepatocyte nuclear factor 4-alpha (HNF-4A) homodimer
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Family Thyroid hormone receptor-like factors
Subfamily Hepatocyte nuclear factor 4
Regulation Type Increase
Regulation Mechanism The APOA2 promoter construct contained the same promoter region with an internal deletion of the element J (-740 to -719) which is the binding site for NF-BA1, HNF-4, ARP-1, EAR-2, and EAR-3. [2]
Evidence Score (E-score) 1 +
1 DNase I Footprint Analysis, Electrophoretic Mobility Shift Assay [2]
UniProt ID
HNF4A_HUMAN
Sequence
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK
IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 4 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-I (APOA1) Clinical trial Target Target Info [18]
2 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [2]
3 Apolipoprotein B-100 (APOB) Clinical trial Target Target Info [6]
4 Apolipoprotein C-III (ApoCIII) Clinical trial Target Target Info [19]
Coagulation factors [+] 1 Coagulation factors Co-regulated By This TF +
1 Coagulation factor VIII (F8) Successful Target Target Info [20]
Hormones [+] 1 Hormones Co-regulated By This TF +
1 Erythropoietin (EPO) Clinical trial Target Target Info [21]
Nuclear hormone receptors [+] 1 Nuclear hormone receptors Co-regulated By This TF +
1 Hepatocyte nuclear factor 4-alpha (HNF4A) Literature-reported Target Target Info [22]
Oxidoreductases [+] 2 Oxidoreductases Co-regulated By This TF +
1 Debrisoquine 4-hydroxylase (CYP2D6) Successful Target Target Info [23]
2 Heme oxygenase 1 (HMOX1) Clinical trial Target Target Info [24]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Coagulation factor IX (F9) Successful Target Target Info [25]
Serpin proteins [+] 1 Serpin proteins Co-regulated By This TF +
1 Angiotensinogen (AGT) Literature-reported Target Target Info [26]
Transferrins [+] 1 Transferrins Co-regulated By This TF +
1 Transferrin (TF) Clinical trial Target Target Info [17]
TF Name Retinoid X receptor alpha (RXR-A)
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Family Thyroid hormone receptor-like factors
Subfamily Retinoid X receptors
Regulation Type Increase
Regulation Mechanism Transient-transfection experiments with a reporter construct driven by the human APOA2gene promoter indicated that 9-cis RA and at-RA, as well as theRXRagonists LGD 1069 and LG 100268, induced APOA2 gene expression at the transcriptional level.. [3]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [3]
UniProt ID
RXRA_HUMAN
Sequence
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Acyltransferases [+] 1 Acyltransferases Co-regulated By This TF +
1 Carnitine O-palmitoyltransferase I (CPT1B) Successful Target Target Info [27]
Apolipoproteins [+] 4 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-I (APOA1) Clinical trial Target Target Info [28]
2 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [3]
3 Apolipoprotein C-III (ApoCIII) Clinical trial Target Target Info [29]
4 Apolipoprotein E (APOE) Clinical trial Target Target Info [30]
Ester hydrolases [+] 1 Ester hydrolases Co-regulated By This TF +
1 Lipoprotein lipase (LPL) Successful Target Target Info [31]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Extracellular calcium-sensing receptor (CASR) Successful Target Target Info [32]
Glycoproteins [+] 2 Glycoproteins Co-regulated By This TF +
1 Cholesteryl ester transfer protein (CETP) Clinical trial Target Target Info [33]
2 Phospholipid transfer protein (PLTP) Literature-reported Target Target Info [34]
Kinases [+] 1 Kinases Co-regulated By This TF +
1 Epidermal growth factor receptor (EGFR) Successful Target Target Info [35]
Mitochondrial carriers [+] 1 Mitochondrial carriers Co-regulated By This TF +
1 Mitochondrial uncoupling protein 3 (UCP3) Clinical trial Target Target Info [36]
Nuclear hormone receptors [+] 4 Nuclear hormone receptors Co-regulated By This TF +
1 Hepatocyte nuclear factor 4-alpha (HNF4A) Literature-reported Target Target Info [22]
2 Retinoic acid receptor beta (RARB) Successful Target Target Info [37]
3 Retinoic acid receptor gamma (RARG) Successful Target Target Info [38]
4 Retinoic acid receptor RXR-gamma (RXRG) Successful Target Target Info [39]
TF Name COUP transcription factor 1 (COUP-TF1) homodimer
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Regulation Type Decrease
Evidence Score (E-score) 1 +
1 DNase I Footprint Analysis, Electrophoretic Mobility Shift Assay [2]
UniProt ID
COT1_HUMAN
Sequence
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGA
PATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTY
TCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLN
GHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF
PDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIR
IFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQY
PNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSI
QCS
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 4 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-I (APOA1) Clinical trial Target Target Info [40]
2 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [2]
3 Apolipoprotein B-100 (APOB) Clinical trial Target Target Info [41]
4 Apolipoprotein C-III (ApoCIII) Clinical trial Target Target Info [42]
Hormones [+] 1 Hormones Co-regulated By This TF +
1 Erythropoietin (EPO) Clinical trial Target Target Info [21]
TF Name COUP transcription factor 2 (COUP-TF2) homodimer
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Regulation Type Decrease
Evidence Score (E-score) 1 +
1 DNase I Footprint Analysis, Electrophoretic Mobility Shift Assay [2]
UniProt ID
COT2_HUMAN
Sequence
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG
YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 4 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-I (APOA1) Clinical trial Target Target Info [43]
2 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [2]
3 Apolipoprotein B-100 (APOB) Clinical trial Target Target Info [41]
4 Apolipoprotein C-III (ApoCIII) Clinical trial Target Target Info [42]
Glycoproteins [+] 1 Glycoproteins Co-regulated By This TF +
1 Cholesteryl ester transfer protein (CETP) Clinical trial Target Target Info [44]
Nuclear hormone receptors [+] 1 Nuclear hormone receptors Co-regulated By This TF +
1 Hepatocyte nuclear factor 4-alpha (HNF4A) Literature-reported Target Target Info [22]
TF Name RXR-alpha/RAR-alpha (RXRA/RARA) heterodimer
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Family Thyroid hormone receptor-like factors
Regulation Type Increase
Regulation Mechanism Transient-transfection experiments with a reporter construct driven by the human APOA2gene promoter indicated that 9-cis RA and at-RA, as well as theRXRagonists LGD 1069 and LG 100268, induced APOA2 gene expression at the transcriptional level.. [3]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [3]
UniProt ID
RXRA_HUMAN/RARA_HUMAN
Sequence
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 1 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [3]
Growth factors [+] 1 Growth factors Co-regulated By This TF +
1 Thrombomodulin (THBD) Discontinued Target Target Info [45]
TF Name Upstream stimulatory factor 2 (USF2) homodimer
Classification Superclass Basic Domains
Class Helix-loop-helix / leucine zipper factors (bHLH-ZIP)
Family Upstream stimulatory factor
Regulation Mechanism Cotransfection experiments in HepG2 cells established the functional significance of USF in APOA2 transcription. It was found that the minimal promoter AB was transactivated by USF2a. [4]
Evidence Score (E-score) 1 +
1 Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay [4]
UniProt ID
USF2_HUMAN
Sequence
MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFG
DHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVD
GAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTA
VSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQH
NEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQET
FKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 2 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [4]
2 Apolipoprotein C-III (ApoCIII) Clinical trial Target Target Info [46]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 C-X-C chemokine receptor type 4 (CXCR4) Successful Target Target Info [47]
References  Top
REF 1 Regulation of the human ApoA-II gene by the synergistic action of factors binding to the proximal and distal regulatory elements. J Biol Chem. 1991 Dec 25;266(36):24460-70.
REF 2 Transcriptional regulation of human apolipoprotein genes ApoB, ApoCIII, and ApoAII by members of the steroid hormone receptor superfamily HNF-4, AR... J Biol Chem. 1992 Aug 5;267(22):15849-60.
REF 3 Retinoids increase human apolipoprotein A-11 expression through activation of the retinoid X receptor but not the retinoic acid receptor. Mol Cell Biol. 1996 Jul;16(7):3350-60.
REF 4 Cooperative binding of upstream stimulatory factor and hepatic nuclear factor 4 drives the transcription of the human apolipoprotein A-II gene. J Biol Chem. 1999 Jan 15;274(3):1216-25.
REF 5 Factors participating in the liver-specific expression of the human apolipoprotein A-II gene and their significance for transcription. Biochemistry. 1993 Sep 7;32(35):9080-93.
REF 6 Identification and characterization of a 315-base pair enhancer, located more than 55 kilobases 5' of the apolipoprotein B gene, that confers expression in the intestine. J Biol Chem. 2000 Aug 25;275(34):26637-48.
REF 7 Structure of the hepatic control region of the human apolipoprotein E/C-I gene locus. J Biol Chem. 1995 Sep 22;270(38):22577-85.
REF 8 Transcriptional regulation by C/EBP alpha and -beta in the expression of the gene for the MRP14 myeloid calcium binding protein. Cell Struct Funct. 1998 Jun;23(3):109-18.
REF 9 Role of the liver-enriched transcription factor hepatocyte nuclear factor 1 in transcriptional regulation of the factor V111 gene. Mol Cell Biol. 1996 May;16(5):1936-45.
REF 10 PU.1 (Spi-1) and C/EBP alpha regulate the granulocyte colony-stimulating factor receptor promoter in myeloid cells. Blood. 1996 Aug 15;88(4):1234-47.
REF 11 The CCAAT/enhancer-binding protein trans-activates the human cholesteryl ester transfer protein gene promoter. J Biol Chem. 1992 Nov 5;267(31):22336-9.
REF 12 The alpha2 and alpha5 integrin genes: identification of transcription factors that regulate promoter activity in epidermal keratinocytes. FEBS Lett. 2000 Jun 2;474(2-3):201-7.
REF 13 Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21.
REF 14 The role of CCAAT/enhancer-binding protein in the differential transcriptional regulation of a family of human liver alcohol dehydrogenase genes. J Biol Chem. 1991 Jun 25;266(18):11594-603.
REF 15 Binding of the Ets factor GA-binding protein to an upstream site in the factor IX promoter is a critical event in transactivation. Mol Cell Biol. 1996 May;16(5):1929-35.
REF 16 CCAAT/enhancer-binding proteins are mediators in the protein kinase A-dependent activation of the decidual prolactin promoter. J Biol Chem. 1999 Aug 27;274(35):24808-18.
REF 17 A different combination of transcription factors modulates the expression of the human transferrin promoter in liver and Sertoli cells. J Biol Chem. 1993 Nov 5;268(31):23399-408.
REF 18 Modulation of transcriptional activation and coactivator interaction by a splicing variation in the F domain of nuclear receptor hepatocyte nuclear factor 4alpha1. Mol Cell Biol. 1999 Oct;19(10):6509-22.
REF 19 Mitogen-activated protein kinase regulates transcription of the ApoCIII gene. Involvement of the orphan nuclear receptor HNF4. J Biol Chem. 1999 Nov 12;274(46):33050-6.
REF 20 cis-acting elements and transcription factors involved in the promoter activity of the human factor VIII gene. J Biol Chem. 1995 May 19;270(20):11828-38.
REF 21 The orphan receptor hepatic nuclear factor 4 functions as a transcriptional activator for tissue-specific and hypoxia-specific erythropoietin gene expression and is antagonized by EAR3/COUP-TF1. Mol Cell Biol. 1995 Apr;15(4):2135-44.
REF 22 Regulatory mechanisms controlling human hepatocyte nuclear factor 4alpha gene expression. Mol Cell Biol. 2001 Nov;21(21):7320-30.
REF 23 Characterization of the human cytochrome P4502D6 promoter. A potential role for antagonistic interactions between members of the nuclear receptor family. J Biol Chem. 1996 Oct 11;271(41):25269-76.
REF 24 Co-operation of the transcription factor hepatocyte nuclear factor-4 with Sp1 or Sp3 leads to transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line. Biochem J. 2002 Nov 1;367(Pt 3):641-52.
REF 25 Disruption of a C/EBP binding site in the factor IX promoter is associated with haemophilia B. Nature. 1990 May 31;345(6274):444-6.
REF 26 Regulated expression of human angiotensinogen gene by hepatocyte nuclear factor 4 and chicken ovalbumin upstream promoter-transcription factor. J Biol Chem. 1999 Dec 3;274(49):34605-12.
REF 27 Co-regulation of tissue-specific alternative human carnitine palmitoyltransferase Ibeta gene promoters by fatty acid enzyme substrate. J Biol Chem. 1998 Dec 4;273(49):32901-9.
REF 28 Bile acid-activated nuclear receptor FXR suppresses apolipoprotein A-I transcription via a negative FXR response element. J Clin Invest. 2002 Apr;109(7):961-71.
REF 29 Mode of action of peroxisome proliferators as hypolipidemic drugs. Suppression of apolipoprotein C-III. J Biol Chem. 1995 Jun 2;270(22):13470-5.
REF 30 LXRs control lipid-inducible expression of the apolipoprotein E gene in macrophages and adipocytes. Proc Natl Acad Sci U S A. 2001 Jan 16;98(2):507-12.
REF 31 PPARalpha and PPARgamma activators direct a distinct tissue-specific transcriptional response via a PPRE in the lipoprotein lipase gene. EMBO J. 1996 Oct 1;15(19):5336-48.
REF 32 Human calcium-sensing receptor gene. Vitamin D response elements in promoters P1 and P2 confer transcriptional responsiveness to 1,25-dihydroxyvitamin D. J Biol Chem. 2002 Aug 16;277(33):30337-50.
REF 33 The orphan nuclear receptor LRH-1 potentiates the sterol-mediated induction of the human CETP gene by liver X receptor. J Biol Chem. 2001 Jul 6;276(27):24767-73.
REF 34 The farnesoid X-activated receptor mediates bile acid activation of phospholipid transfer protein gene expression. J Biol Chem. 2000 Dec 15;275(50):39313-7.
REF 35 T3 receptor suppression of Sp1-dependent transcription from the epidermal growth factor receptor promoter via overlapping DNA-binding sites. J Biol Chem. 1993 Jul 25;268(21):16065-73.
REF 36 The human uncoupling protein-3 gene promoter requires MyoD and is induced by retinoic acid in muscle cells. FASEB J. 2000 Nov;14(14):2141-3.
REF 37 Vitamin D represses retinoic acid-dependent transactivation of the retinoic acid receptor-beta2 promoter: the AF-2 domain of the vitamin D receptor is required for transrepression. Endocrinology. 1999 Jun;140(6):2898-907.
REF 38 RAR gamma 2 expression is regulated through a retinoic acid response element embedded in Sp1 sites. Mol Cell Biol. 1992 Jul;12(7):2976-85.
REF 39 Identification of thyroid hormone response elements in the human fatty acid synthase promoter. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12260-5.
REF 40 COUP orphan receptors are negative regulators of retinoic acid response pathways. Mol Cell Biol. 1992 Oct;12(10):4666-76.
REF 41 Transcriptional regulation of the apolipoprotein B100 gene: purification and characterization of trans-acting factor BRF-2. Mol Cell Biol. 1992 Jul;12(7):3183-91.
REF 42 Antagonism between apolipoprotein AI regulatory protein 1, Ear3/COUP-TF, and hepatocyte nuclear factor 4 modulates apolipoprotein CIII gene expression in liver and intestinal cells. Mol Cell Biol. 1992 Apr;12(4):1708-18.
REF 43 Intestinal apolipoprotein AI gene transcription is regulated by multiple distinct DNA elements and is synergistically activated by the orphan nuclear receptor, hepatocyte nuclear factor 4. J Clin Invest. 1995 Jul;96(1):528-38.
REF 44 Transcriptional regulation of the cholesteryl ester transfer protein gene by the orphan nuclear hormone receptor apolipoprotein AI regulatory protein-1. J Biol Chem. 1995 Dec 15;270(50):29916-22.
REF 45 Acceleration of thrombomodulin gene transcription by retinoic acid: retinoic acid receptors and Sp1 regulate the promoter activity through interactions with two different sequences in the 5'-flanking region of human gene. J Biol Chem. 2001 Jan 26;276(4):2440-50.
REF 46 Two initiator-like elements are required for the combined activation of the human apolipoprotein C-III promoter by upstream stimulatory factor and ... J Biol Chem. 2002 Apr 26;277(17):15199-206.
REF 47 USF/c-Myc enhances, while Yin-Yang 1 suppresses, the promoter activity of CXCR4, a coreceptor for HIV-1 entry. J Immunol. 1999 May 15;162(10):5986-92.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.