Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T98913 | Target Info | |||
Target Name | Granulocyte colony-stimulating factor receptor (G-CSF-R) | ||||
Synonyms | c-fms; GCSFR; GCSF receptor; G-CSF receptor; Fms proto-oncogene; CD114 | ||||
Target Type | Successful Target | ||||
Gene Name | CSF3R | ||||
Biochemical Class | Cytokine receptor | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | C/EBP alpha (CEBPA) homodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Leucine zipper factors (bZIP) | ||||
Family | C/EBP-like factors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | There are two regions that are important for GCSFR promoter activity. One region, located at bp -49, contains a GCAAT site that specifically binds the C/EBP alpha transcription factor in myeloid nuclear extracts. Mutation of this site prevents C/EBP alpha binding and reduces promoter activity by 60%. The other functionally important region of GCSFR promoter is in the 5' untranslated region, at bp +36 and +43, where there are two sites for the ets family member PU.1. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
UniProt ID | |||||
Sequence |
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 3 Apolipoproteins Co-regulated By This TF | + | |||
Calcium-binding proteins | [+] 1 Calcium-binding proteins Co-regulated By This TF | + | |||
Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Glycoproteins | [+] 1 Glycoproteins Co-regulated By This TF | + | |||
Integrins | [+] 1 Integrins Co-regulated By This TF | + | |||
Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
Somatotropin / Prolactins | [+] 1 Somatotropin / Prolactins Co-regulated By This TF | + | |||
Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
TF Name | PU.1 proto-oncogene (SPI1) | ||||
Classification | Superclass | Helix-turn-helix | |||
Class | Tryptophan clusters | ||||
Family | Ets-type | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | There are two regions that are important for GCSFR promoter activity. One region, located at bp -49, contains a GCAAT site that specifically binds the C/EBP alpha transcription factor in myeloid nuclear extracts. Mutation of this site prevents C/EBP alpha binding and reduces promoter activity by 60%. The other functionally important region of GCSFR promoter is in the 5' untranslated region, at bp +36 and +43, where there are two sites for the ets family member PU.1. | [1] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHS
EFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQ YPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLL RSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGE VKKVKKKLTYQFSGEVLGRGGLAERRHPPH |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 4 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Integrins | [+] 1 Integrins Co-regulated By This TF | + |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | PU.1 (Spi-1) and C/EBP alpha regulate the granulocyte colony-stimulating factor receptor promoter in myeloid cells. Blood. 1996 Aug 15;88(4):1234-47. | ||||
REF 2 | Essential role of C/EBPalpha in G-CSF-induced transcriptional activation and chromatin modification of myeloid-specific genes. Genes Cells. 2008 Apr;13(4):313-27. | ||||
REF 3 | Regulation of the human ApoA-II gene by the synergistic action of factors binding to the proximal and distal regulatory elements. J Biol Chem. 1991 Dec 25;266(36):24460-70. | ||||
REF 4 | Identification and characterization of a 315-base pair enhancer, located more than 55 kilobases 5' of the apolipoprotein B gene, that confers expression in the intestine. J Biol Chem. 2000 Aug 25;275(34):26637-48. | ||||
REF 5 | Structure of the hepatic control region of the human apolipoprotein E/C-I gene locus. J Biol Chem. 1995 Sep 22;270(38):22577-85. | ||||
REF 6 | Transcriptional regulation by C/EBP alpha and -beta in the expression of the gene for the MRP14 myeloid calcium binding protein. Cell Struct Funct. 1998 Jun;23(3):109-18. | ||||
REF 7 | Role of the liver-enriched transcription factor hepatocyte nuclear factor 1 in transcriptional regulation of the factor V111 gene. Mol Cell Biol. 1996 May;16(5):1936-45. | ||||
REF 8 | The CCAAT/enhancer-binding protein trans-activates the human cholesteryl ester transfer protein gene promoter. J Biol Chem. 1992 Nov 5;267(31):22336-9. | ||||
REF 9 | The alpha2 and alpha5 integrin genes: identification of transcription factors that regulate promoter activity in epidermal keratinocytes. FEBS Lett. 2000 Jun 2;474(2-3):201-7. | ||||
REF 10 | Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21. | ||||
REF 11 | The role of CCAAT/enhancer-binding protein in the differential transcriptional regulation of a family of human liver alcohol dehydrogenase genes. J Biol Chem. 1991 Jun 25;266(18):11594-603. | ||||
REF 12 | Binding of the Ets factor GA-binding protein to an upstream site in the factor IX promoter is a critical event in transactivation. Mol Cell Biol. 1996 May;16(5):1929-35. | ||||
REF 13 | CCAAT/enhancer-binding proteins are mediators in the protein kinase A-dependent activation of the decidual prolactin promoter. J Biol Chem. 1999 Aug 27;274(35):24808-18. | ||||
REF 14 | A different combination of transcription factors modulates the expression of the human transferrin promoter in liver and Sertoli cells. J Biol Chem. 1993 Nov 5;268(31):23399-408. | ||||
REF 15 | IL-4-activated STAT-6 inhibits IFN-gamma-induced CD40 gene expression in macrophages/microglia. J Immunol. 2000 Dec 1;165(11):6235-43. | ||||
REF 16 | Monocyte expression of the human prointerleukin 1 beta gene (IL1B) is dependent on promoter sequences which bind the hematopoietic transcription fa... Mol Cell Biol. 1995 Jan;15(1):58-68. | ||||
REF 17 | Identification and characterization of a novel Ets-2-related nuclear complex implicated in the activation of the human interleukin-12 p40 gene prom... J Biol Chem. 1997 Apr 18;272(16):10389-95. | ||||
REF 18 | CD18 (beta 2 leukocyte integrin) promoter requires PU.1 transcription factor for myeloid activity. Proc Natl Acad Sci U S A. 1995 Jan 31;92(3):801-5. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.